Overview

  • Product nameAnti-KMT1B / SUV39H2 antibody
    See all KMT1B / SUV39H2 primary antibodies
  • Description
    Rabbit polyclonal to KMT1B / SUV39H2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human KMT1B/ SUV39H2 aa 347-396 (internal sequence).
    Sequence:

    LDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRT


    Database link: Q9H5I1

  • Positive control
    • HepG2 cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab104343 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 47 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionHistone methyltransferase that specifically trimethylates 'Lys-9' of histone H3 using monomethylated H3 'Lys-9' as substrate. H3 'Lys-9' trimethylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1, CBX3 and/or CBX5) proteins to methylated histones. Mainly functions in heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin at pericentric and telomere regions. H3 'Lys-9' trimethylation is also required to direct DNA methylation at pericentric repeats. SUV39H1 is targeted to histone H3 via its interaction with RB1 and is involved in many processes, such as cell cycle regulation, transcriptional repression and regulation of telomere length. May participate in regulation of higher order chromatin organization during spermatogenesis.
  • Sequence similaritiesBelongs to the histone-lysine methyltransferase family. Suvar3-9 subfamily.
    Contains 1 chromo domain.
    Contains 1 post-SET domain.
    Contains 1 pre-SET domain.
    Contains 1 SET domain.
  • DomainAlthough the SET domain contains the active site of enzymatic activity, both pre-SET and post-SET domains are required for methyltransferase activity. The SET domain also participates to stable binding to heterochromatin.
  • Cellular localizationNucleus. Chromosome > centromere. Associates with centromeric constitutive heterochromatin.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ23414 antibody
    • H3 K9 HMTase 2 antibody
    • H3-K9-HMTase 2 antibody
    • Histone H3 K9 methyltransferase 2 antibody
    • Histone H3-K9 methyltransferase 2 antibody
    • Histone lysine N methyltransferase H3 lysine 9 specific 2 antibody
    • Histone lysine N methyltransferase SUV39H2 antibody
    • Histone-lysine N-methyltransferase SUV39H2 antibody
    • KMT1B antibody
    • Lysine N methyltransferase 1B antibody
    • Lysine N-methyltransferase 1B antibody
    • sSuppressor of variegation 3 9 homolog 2 (Drosophila) antibody
    • Su(var)3 9 Drosophila homolog of 2 antibody
    • Su(var)3 9 homolog 2 antibody
    • Su(var)3-9 homolog 2 antibody
    • Suppressor of variegation 3 9 homolog 2 antibody
    • Suppressor of variegation 3-9 homolog 2 antibody
    • Suv39h2 antibody
    • SUV92_HUMAN antibody
    see all

Anti-KMT1B / SUV39H2 antibody images

  • Anti-KMT1B / SUV39H2 antibody (ab104343) at 1 µg/ml + HepG2 cell lysate at 10 µg

    Predicted band size : 47 kDa

References for Anti-KMT1B / SUV39H2 antibody (ab104343)

ab104343 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104343.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"