Anti-KMT2B / MLL4 antibody [4C10] (ab56770)
Key features and details
- Mouse monoclonal [4C10] to KMT2B / MLL4
- Suitable for: WB, Flow Cyt
- Reacts with: Human, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-KMT2B / MLL4 antibody [4C10]
See all KMT2B / MLL4 primary antibodies -
Description
Mouse monoclonal [4C10] to KMT2B / MLL4 -
Host species
Mouse -
Tested applications
Suitable for: WB, Flow Cytmore details -
Species reactivity
Reacts with: Human, Recombinant fragment -
Immunogen
Recombinant fragment (proprietary-tag) corresponding to Human KMT2B/ MLL4 aa 813-904. Entrez gene ID: 9757
Sequence:KVAASMPLSPGGQMEEVAGAVKQISDRGPVRSEDESVEAKRERPSGPESP VQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRDRQDL
Database link: Q9UMN6 -
General notes
This product was changed from ascites to tissue culture supernatant on 11th June 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.4 -
Concentration information loading...
-
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Clone number
4C10 -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab56770 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (1) |
Use at an assay dependent concentration.
This antibody has only been tested in WB against the recombinant fragment used as immunogen. We have no data on the detection of endogenous protein. |
Flow Cyt |
Use at an assay dependent concentration.
ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
Notes |
---|
WB
Use at an assay dependent concentration. This antibody has only been tested in WB against the recombinant fragment used as immunogen. We have no data on the detection of endogenous protein. |
Flow Cyt
Use at an assay dependent concentration. ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
Target
-
Function
Histone methyltransferase. Methylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Plays a central role in beta-globin locus transcription regulation by being recruited by NFE2. Plays an important role in controlling bulk H3K4me during oocyte growth and preimplantation development. Required during the transcriptionally active period of oocyte growth for the establishment and/or maintenance of bulk H3K4 trimethylation (H3K4me3), global transcriptional silencing that preceeds resumption of meiosis, oocyte survival and normal zygotic genome activation. -
Tissue specificity
Widely expressed. Highest levels in testis. Also found in brain, bone marrow, heart, muscle, kidney, placenta, spleen, thymus, prostate, ovary, intestine, colon, peripheral blood lymphocytes and pancreas. Often amplified in pancreatic carcinomas. -
Sequence similarities
Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. TRX/MLL subfamily.
Contains 3 A.T hook DNA-binding domains.
Contains 1 CXXC-type zinc finger.
Contains 1 FYR C-terminal domain.
Contains 1 FYR N-terminal domain.
Contains 3 PHD-type zinc fingers.
Contains 1 post-SET domain.
Contains 1 SET domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 9757 Human
- Omim: 606834 Human
- SwissProt: Q9UMN6 Human
- Unigene: 676457 Human
- Unigene: 92236 Human
-
Alternative names
- Histone-lysine N-methyltransferase 2B antibody
- HRX2 antibody
- KIAA0304 gene product antibody
see all
Images
-
Western blot against tagged recombinant protein immunogen using ab56770 MLL4 antibody at 1ug/ml. Predicted band size of immunogen is 36 kDa
This image was generated using the ascites version of the product.
-
Overlay histogram showing HL60 cells stained with ab56770 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab56770, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Unlabelled sample (blue line). Acquisition of >5,000 events were collected using a 20mW Argon ion laser (488nm) and 525/30 bandpass filter.
This image was generated using the ascites version of the product.
Datasheets and documents
-
Datasheet download
References (1)
ab56770 has been referenced in 1 publication.
- Zhao G et al. M2-like tumor-associated macrophages transmit exosomal miR-27b-3p and maintain glioblastoma stem-like cell properties. Cell Death Discov 8:350 (2022). PubMed: 35927251