Overview

  • Product name
    Anti-KMT2D / MLL2 antibody
    See all KMT2D / MLL2 primary antibodies
  • Description
    Rabbit polyclonal to KMT2D / MLL2
  • Tested applications
    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human KMT2D/ MLL2 aa 4363-4491.
    Sequence:

    AQLADTLFSKGLGPWDPPDNLAETQKPEQSSLVPGHLDQVNGQVVPEASQ LSIKQEPREEPCALGAQSVKREANGEPIGAPGTSNHLLLAGPRSEAGHLL LQKLLRAKNVQLSTGRGSEGLRAEINGHI


    Database link: O14686

  • Positive control
    • IHC-P: Human cerebral cortex tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224156 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function
    Histone methyltransferase. Methylates 'Lys-4' of histone H3 (H3K4me). H3K4me represents a specific tag for epigenetic transcriptional activation. Plays a central role in beta-globin locus transcription regulation by being recruited by NFE2. Acts as a coactivator for estrogen receptor by being recruited by ESR1, thereby activating transcription. Plays an important role in controlling bulk H3K4me during oocyte growth and preimplantation development. Required during the transcriptionally active period of oocyte growth for the establishment and/or maintenance of bulk H3K4 trimethylation (H3K4me3), global transcriptional silencing that preceeds resumption of meiosis, oocyte survival and normal zygotic genome activation.
  • Tissue specificity
    Expressed in most adult tissues, including a variety of hematoipoietic cells, with the exception of the liver.
  • Involvement in disease
    Defects in MLL2 are the cause of Kabuki syndrome (KABS) [MIM:147920]. It is a congenital mental retardation syndrome with additional features, including postnatal dwarfism, a peculiar facies characterized by long palpebral fissures with eversion of the lateral third of the lower eyelids, a broad and depressed nasal tip, large prominent earlobes, a cleft or high-arched palate, scoliosis, short fifth finger, persistence of fingerpads, radiographic abnormalities of the vertebrae, hands, and hip joints, and recurrent otitis media in infancy.
  • Sequence similarities
    Belongs to the histone-lysine methyltransferase family. TRX/MLL subfamily.
    Contains 1 FY-rich C-terminal domain.
    Contains 1 FY-rich N-terminal domain.
    Contains 5 PHD-type zinc fingers.
    Contains 1 post-SET domain.
    Contains 4 RING-type zinc fingers.
    Contains 1 SET domain.
  • Domain
    LXXLL motifs 5 and 6 are essential for the association with ESR1 nuclear receptor.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • AAD10 antibody
    • ALL1 related gene antibody
    • ALL1-related protein antibody
    • ALR antibody
    • CAGL114 antibody
    • Histone-lysine N-methyltransferase MLL2 antibody
    • KABUK1 antibody
    • Kabuki make up syndrome antibody
    • Kabuki mental retardation syndrome antibody
    • KMS antibody
    • KMT2B antibody
    • KMT2D antibody
    • Lysine N methyltransferase 2D antibody
    • Lysine N-methyltransferase 2B antibody
    • MLL2 antibody
    • MLL2_HUMAN antibody
    • MLL4 antibody
    • Myeloid/lymphoid or mixed lineage leukemia 2 antibody
    • Myeloid/lymphoid or mixed-lineage leukemia protein 2 antibody
    • TNRC21 antibody
    • Trinucleotide repeat containing 21 antibody
    see all

Images

  • Paraffin-embedded human cerebral cortex tissue stained for KMT2D / MLL2 using ab224156 at 1/200 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for KMT2D / MLL2 (green) using ab224156 at 4 µg/ml in ICC/IF.

References

ab224156 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224156.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up