Overview

  • Product nameAnti-KMT2H / ASH1 antibody [ASH5H03]
    See all KMT2H / ASH1 primary antibodies
  • Description
    Mouse monoclonal [ASH5H03] to KMT2H / ASH1
  • Tested applicationsSuitable for: Dot blot, WBmore details
  • Species reactivity
    Reacts with: Recombinant Fragment
    Predicted to work with: Human
  • Immunogen

    Recombinant fragment corresponding to Human KMT2H/ ASH1 aa 1611-1728.
    Sequence:

    IGSCRVSNPNSSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTL AGSQPTSDKPSQRPSESTNCSPTRKRSSSESTSSTVNGVPSRSPRLVASG DDSVDSLLQRMVQNEDQE

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage bufferPreservative: 0.05% Sodium Azide
    Constituents: 1% BSA, PBS, 8mM Sodium phosphate, 3mM Potassium chloride, 140mM Sodium chloride, 1.5mM Potassium phosphate, pH 7.4
  • Concentration information loading...
  • PurityProtein G purified
  • Purification notesab50981 was purified using protein G column chromatography from culture supernatant of hybridoma cultured in a medium containing bovine IgG-depleted (approximately 95%) fetal bovine serum
  • ClonalityMonoclonal
  • Clone numberASH5H03
  • IsotypeIgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab50981 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Dot blot
WB
  • Application notesDot: Use at an assay dependent dilution.
    WB: Use at an assay dependent dilution. Predicted molecular weight: 330 kDa.

    This antibody has only been tested in WB against the recombinant fragment used as immunogen. We have no data on the detection of endogenous protein.

    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Target

    • FunctionHistone methyltransferase. Probably methylates 'Lys-4' of histone H3, a specific tag for epigenetic transcriptional activation.
    • Tissue specificityWidely expressed, with highest level in brain, heart and kidney.
    • Sequence similaritiesBelongs to the histone-lysine methyltransferase family. SET2 subfamily.
      Contains 3 A.T hook DNA-binding domains.
      Contains 1 AWS domain.
      Contains 1 BAH domain.
      Contains 1 bromo domain.
      Contains 1 PHD-type zinc finger.
      Contains 1 post-SET domain.
      Contains 1 SET domain.
    • Cellular localizationNucleus. Cell junction > tight junction. Chromosome. The relevance of tight junction localization is however unclear.
    • Information by UniProt
    • Database links
    • Alternative names
      • Absent small and homeotic disks protein 1 homolog antibody
      • Absent Small or Homeotic Like antibody
      • Absent Small or Homeotic Like antibody
      • ASH 1 antibody
      • ASH 1L antibody
      • ash1 (absent small or homeotic 1) antibody
      • Ash1 (absent small or homeotic) like antibody
      • ASH1-like protein antibody
      • ASH1L antibody
      • ASH1L_HUMAN antibody
      • ASH1L1 antibody
      • FLJ10504 antibody
      • huASH1 antibody
      • KIAA1420 antibody
      • Lysine N-methyltransferase 2H antibody
      • Probable histone-lysine N-methyltransferase ASH1L antibody
      see all

    Anti-KMT2H / ASH1 antibody [ASH5H03] images

    References for Anti-KMT2H / ASH1 antibody [ASH5H03] (ab50981)

    This product has been referenced in:
    • Atta H  et al. Mutant MMP-9 and HGF gene transfer enhance resolution of CCl4-induced liver fibrosis in rats: role of ASH1 and EZH2 methyltransferases repression. PLoS One 9:e112384 (2014). Dot blot . Read more (PubMed: 25380300) »

    See 1 Publication for this product

    Product Wall

    There are currently no Abreviews or Questions for ab50981.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"