Anti-KMT3B / NSD1 antibody (ab89432)

Overview

  • Product nameAnti-KMT3B / NSD1 antibody
    See all KMT3B / NSD1 primary antibodies
  • Description
    Mouse monoclonal to KMT3B / NSD1
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human KMT3B/ NSD1 aa 2-109.
    Sequence:

    DQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLS TVSGTSQNAYGQDSPSCYIPLRRLQDLASMINVEYLNGSADGSESFQDPE KSDSRAQT


    Database link: Q96L73

  • Positive control
    • Human uterus myoma tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab89432 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 297 kDa.
ELISA Use at an assay dependent dilution.

Target

  • FunctionHistone methyltransferase. Preferentially methylates 'Lys-36' of histone H3 and 'Lys-20' of histone H4 (in vitro). Transcriptional intermediary factor capable of both negatively or positively influencing transcription, depending on the cellular context.
  • Tissue specificityExpressed in the fetal/adult brain, kidney, skeletal muscle, spleen, and the thymus, and faintly in the lung.
  • Involvement in diseaseDefects in NSD1 are the cause of Sotos syndrome (SOTOSS) [MIM:117550]; also known as cerebral gigantism. It is a disorder characterized by excessively rapid growth, acromegalic features, and a nonprogressive cerebral disorder with mental retardation. High-arched palate and prominent jaw are noted in several patients. Most cases of Sotos syndrome are sporadic and may represent new dominant mutation.
    Defects in NSD1 are the cause of Weaver syndrome (WES) [MIM:277590]. WES is a syndrome of accelerated growth and osseous maturation, unusual craniofacial appearance, hoarse and low-pitched cry, and hypertonia with camptodactyly.
    Defects in NSD1 are a cause of Beckwith-Wiedemann syndrome (BWS) [MIM:130650]. BWS is a genetically heterogeneous disorder characterized by anterior abdominal wall defects including exomphalos (omphalocele), pre- and postnatal overgrowth, and macroglossia. Additional less frequent complications include specific developmental defects and a predisposition to embryonal tumors.
    Note=A chromosomal aberration involving NSD1 is found in childhood acute myeloid leukemia. Translocation t(5;11)(q35;p15.5) with NUP98.
    Note=A chromosomal aberration involving NSD1 is found in an adult form of myelodysplastic syndrome (MDS). Insertion of NUP98 into NSD1 generates a NUP98-NSD1 fusion product.
  • Sequence similaritiesBelongs to the histone-lysine methyltransferase family.
    Contains 1 AWS domain.
    Contains 4 PHD-type zinc fingers.
    Contains 1 post-SET domain.
    Contains 2 PWWP domains.
    Contains 1 SET domain.
  • Cellular localizationNucleus. Chromosome.
  • Information by UniProt
  • Database links
  • Alternative names
    • Androgen receptor coactivator 267 kDa protein antibody
    • Androgen receptor-associated protein of 267 kDa antibody
    • ARA267 antibody
    • H3 K36 HMTase antibody
    • H3-K36-HMTase antibody
    • H4 K20 HMTase antibody
    • H4-K20-HMTase antibody
    • Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific antibody
    • KMT3B antibody
    • Lysine N-methyltransferase 3B antibody
    • NR binding SET domain containing protein antibody
    • NR-binding SET domain-containing protein antibody
    • Nsd1 antibody
    • NSD1_HUMAN antibody
    • Nuclear receptor binding SET domain containing protein 1 antibody
    • Nuclear receptor-binding SET domain-containing protein 1 antibody
    see all

Anti-KMT3B / NSD1 antibody images

  • Anti-KMT3B / NSD1 antibody (ab89432) at 1 µg/ml + KMT3B / NSD1 partial recombinant protein at 0.2 µg

    Predicted band size : 297 kDa
    Observed band size : 38 kDa (why is the actual band size different from the predicted?)
  • Anti-KMT3B / NSD1 antibody (ab89432) at 1 µg/ml + Human uterus myoma tissue lysate at 50 µg

    Predicted band size : 297 kDa
    Observed band size : 297 kDa
    Additional bands at : 60 kDa. We are unsure as to the identity of these extra bands.

References for Anti-KMT3B / NSD1 antibody (ab89432)

ab89432 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your inquiry.

Most antibodies will work fine with either BSA or milk.

When testing our antibodies, our lab uses 5% BSA as a blocking reagent, so I recommend this.

Some antibodies give stronger, more specific ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"