Overview

  • Product name
  • Description
    Rabbit polyclonal to KPNA4
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IP, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rabbit, Horse, Cow, Dog, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan
  • Immunogen

    Synthetic peptide within Human KPNA4 aa 471-521 (C terminal). The exact sequence is proprietary. (NP_002259.1).
    Sequence:

    EDIYKLAYEIIDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQ F


    Database link: O00629

  • Positive control
    • HeLa and 293T whole cell lysates; Human Ovarian Carcinoma and Prostate Carcinoma tissues.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 99% Tris buffered saline, 0.1% BSA
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab176585 was affinity purified using an epitope specific to KPNA4 immobilized on solid support.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab176585 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 57 kDa.
IP Use at 2-5 µg/mg of lysate.
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF 1/50 - 1/250.

Target

  • Function
    Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS. In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS.
  • Tissue specificity
    Highly expressed in testis, ovary, small intestine, heart, skeletal muscle, lung and pancreas, but barely detectable in kidney, thymus, colon and peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the importin alpha family.
    Contains 10 ARM repeats.
    Contains 1 IBB domain.
  • Domain
    Consists of an N-terminal hydrophilic region, a hydrophobic central region composed of 10 repeats, and a short hydrophilic C-terminus. The N-terminal hydrophilic region contains the importin beta binding domain (IBB domain), which is sufficient for binding importin beta and essential for nuclear protein import.
    The IBB domain is thought to act as an intrasteric autoregulatory sequence by interacting with the internal autoinhibitory NLS. Binding of KPNB1 probably overlaps the internal NLS and contributes to a high affinity for cytoplasmic NLS-containing cargo substrates. After dissociation of the importin/substrate complex in the nucleus the internal autohibitory NLS contributes to a low affinity for nuclear NLS-containing proteins.
    The major and minor NLS binding sites are mainly involved in recognition of simple or bipartite NLS motifs. Structurally located within in a helical surface groove they contain several conserved Trp and Asn residues of the corresponding third helices (H3) of ARM repeats which mainly contribute to binding.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ31113 antibody
    • IMA3_HUMAN antibody
    • Importin alpha 3 antibody
    • Importin alpha 4 subunit antibody
    • Importin alpha Q1 antibody
    • Importin subunit alpha 3 antibody
    • Importin subunit alpha-3 antibody
    • IPO A3 antibody
    • IPOA 3 antibody
    • IPOA3 antibody
    • Karyopherin alpha 4 (importin alpha 3) antibody
    • Karyopherin alpha 4 antibody
    • Karyopherin alpha 4 importin alpha 3 antibody
    • Karyopherin alpha 4 subunit antibody
    • Karyopherin subunit alpha 4 antibody
    • Karyopherin subunit alpha-4 antibody
    • KPNA 4 antibody
    • Kpna4 antibody
    • MGC12217 antibody
    • MGC26703 antibody
    • OTTHUMP00000213880 antibody
    • QIP 1 antibody
    • Qip1 antibody
    • Qip1 protein antibody
    • SRP 3 antibody
    • SRP3 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human prostate carcinoma tissue labeling KPNA4  with ab176585 at 1µg/ml.

  • All lanes : Anti-KPNA4 antibody (ab176585) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 5 µg
    Lane 4 : 293T whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 57 kDa


    Exposure time: 3 seconds
  • Detection of KPNA4 in Immunoprecipitates of Jurkat whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176585 at 3 µg/mg lysate for IP (Lane 1). For WB detection ab176585 was used at 0.4 µg/ml. Lane 2 represents control IgG IP.

    Detection: Chemiluminescence with an exposure time of 0.5 seconds.

References

This product has been referenced in:
  • Sun B  et al. Citrullination of NF-?B p65 promotes its nuclear localization and TLR-induced expression of IL-1ß and TNFa. Sci Immunol 2:N/A (2017). Read more (PubMed: 28783661) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176585.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up