
  • Product name
    Anti-KRTAP24-1 antibody
  • Description
    Rabbit polyclonal to KRTAP24-1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Horse, Cat
  • Immunogen

    Synthetic peptide corresponding to a region within the internal amino acids 205-254 (VRNYHYSSYRPTSCRPLSYLSRSFRSLSYIPSTFPPLRYLCSGSRPLKC Y) of human KRTAP24-1 (NP_001078924).

  • Positive control
    • 293T cell lysate



Our Abpromise guarantee covers the use of ab87217 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 28 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Relevance
    In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
  • Cellular localization
    Intermediate filaments
  • Database links
  • Alternative names
    • Gm312 antibody
    • KAP24.1 antibody
    • Keratin associated protein 24-1 antibody
    • KRTAP24-1 keratin associated protein 24-1 antibody
    • OTTHUMP00000155134 antibody
    see all

Anti-KRTAP24-1 antibody images

  • Anti-KRTAP24-1 antibody (ab87217) at 1 µg/ml + 293T cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 28 kDa
    Observed band size : 35 kDa (why is the actual band size different from the predicted?)

References for Anti-KRTAP24-1 antibody (ab87217)

ab87217 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab87217.
Please use the links above to contact us or submit feedback about this product.


Sign up