Overview

  • Product nameAnti-Kv1.2 antibody [S14-16]
    See all Kv1.2 primary antibodies
  • Description
    Mouse monoclonal [S14-16] to Kv1.2
  • SpecificityDoes not cross react with KCNA1, KCNA3, KCNA4, and KCNA6 expressed in transfected cells.
  • Tested applicationsSuitable for: Flow Cyt, ICC, WB, IHC-P, IHC-Frmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human, Xenopus laevis, Zebrafish
    Predicted to work with: Rabbit, Chicken, Cow, Dog, Pig
  • Immunogen

    Fusion protein corresponding to Rat Kv1.2 aa 428-499 (C terminal).
    Sequence:

    QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENL KTANCTLANTNYVNITKMLTDV

  • Positive control
    • Rat brain lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at -20°C. Stable for 12 months at -20°C.
  • Storage bufferPreservative: 0.09% Sodium Azide
    Constituents: 50% Glycerol, PBS, pH 7.4
  • Concentration information loading...
  • PurityProtein G purified
  • ClonalityMonoclonal
  • Clone numberS14-16
  • IsotypeIgG2b
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab98970 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use 1µg for 106 cells. ab170192-Mouse monoclonal IgG2b, is suitable for use as an isotype control with this antibody.
ICC Use a concentration of 0.1 - 1 µg/ml.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 57 kDa.
IHC-P Use a concentration of 0.1 - 1 µg/ml.
IHC-Fr Use a concentration of 0.1 - 1 µg/ml.

Target

  • RelevanceKv1.2 mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which K(+) ions may pass in accordance with their electrochemical gradient. Kv1.2 binds PDZ domains of DLG1, DLG2 and DLG4. The N-terminus may be important in determining the rate of inactivation of the channel while the tail may play a role in modulation of channel activity and/or targeting of the channel to specific subcellular compartments.
  • Cellular localizationMembrane; Multi-pass membrane protein
  • Database links
  • Alternative names
    • Akr6a4 antibody
    • BK2 antibody
    • HBK5 antibody
    • HK4 antibody
    • HUKIV antibody
    • Kca1 2 antibody
    • kcna2 antibody
    • KV1.2 antibody
    • MGC50217 antibody
    • Mk 2 antibody
    • MK2 antibody
    • NGK1 antibody
    • Potassium voltage gated channel shaker related subfamily member 2 antibody
    • Potassium voltage-gated channel subfamily A member 2 antibody
    • RBK2 antibody
    • Voltage gated potassium channel subunit Kv1.2 antibody
    see all

Anti-Kv1.2 antibody [S14-16] images

  • Overlay histogram showing SH-SY5Y cells stained with ab98970 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab98970, 1μg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG2b [PLPV219] (ab91366, 1μg/1x106 cells) used under the same conditions. Unlabelled sample (blue line) was also used as a control. Acquisition of >5,000 events were collected using a 20mW Argon ion laser (488nm) and 525/30 bandpass filter.

References for Anti-Kv1.2 antibody [S14-16] (ab98970)

ab98970 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98970.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"