
  • Product nameAnti-Kv2.1 antibody
    See all Kv2.1 primary antibodies
  • Description
    Rabbit polyclonal to Kv2.1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 755-804 (IDADTDDEGQLLYSVDSSPPKSLPGSTSPKFSTGTRSEKNHFESSPLPT S) of Human KCNB1 (NP_004966)

  • Positive control
    • HepG2 cell lysate


  • FormLiquid
  • Storage instructionsShipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas


Our Abpromise guarantee covers the use of ab86513 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 96 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • FunctionMediates the voltage-dependent potassium ion permeability of excitable membranes. Channels open or close in response to the voltage difference across the membrane, letting potassium ions pass in accordance with their electrochemical gradient.
  • Sequence similaritiesBelongs to the potassium channel family. B (Shab) (TC 1.A.1.2) subfamily. Kv2.1/KCNB1 sub-subfamily.
  • DomainThe segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
    The tail may be important in modulation of channel activity and/or targeting of the channel to specific subcellular compartments.
  • Post-translational
    Highly phosphorylated on serine residues in the C-terminal. Differential phosphorylation on a subset of serines allows graded activity-dependent regulation of channel gating. Phosphorylation on Ser-457, Ser-541, Ser-567, Ser-607, Ser-656 and Ser-720 as well as the N-terminal Ser-15 are all regulated by calcineurin-mediated dephosphorylation. Particularly, Ser-607 and Tyr-128 are significant sites of voltage-gated regulation through phosphorylation/ dephosphorylation activities. Tyr-128 can be dephosphorylated by PTPalpha and cyt-PTPepsilon. Phosphorylation levels on Ser-607 are supersensitive to neuronal activity. Phosphorylation on Ser-567 is reduced during postnatal development with low levels at P2 and P5. Levels then increase to reach adult levels by P14. Phosphorylation levels on Ser-564 and Ser-607 are greatly reduced during seizures, by 40% and 85% respectively.
  • Cellular localizationMembrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Delayed rectifier potassium channel 1 antibody
    • Delayed rectifier potassium channel Kv2.1 antibody
    • DRK 1 antibody
    • DRK1 antibody
    • h DRK1 K(+) channel antibody
    • h-DRK1 antibody
    • hDRK 1 antibody
    • hDRK1 antibody
    • KCB 1 antibody
    • KCB1 antibody
    • KCNB1 antibody
    • KCNB1_HUMAN antibody
    • KV2.1 antibody
    • Potassium channel protein DRK1 antibody
    • Potassium voltage gated channel shab related subfamily member 1 antibody
    • Potassium voltage-gated channel subfamily B member 1 antibody
    • Voltage-gated potassium channel subunit Kv2.1 antibody
    see all

Anti-Kv2.1 antibody images

  • Anti-Kv2.1 antibody (ab86513) at 1 µg/ml + HepG2 cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 96 kDa

References for Anti-Kv2.1 antibody (ab86513)

ab86513 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab86513.
Please use the links above to contact us or submit feedback about this product.