Anti-L-ascorbate peroxidase 2 antibody (FITC) (ab192946)

Overview

  • Product name
    Anti-L-ascorbate peroxidase 2 antibody (FITC)
  • Description
    Rabbit Polyclonal to L-ascorbate peroxidase 2 (FITC)
  • Conjugation
    FITC. Ex: 493nm, Em: 528nm
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Arabidopsis thaliana
  • Immunogen

    Recombinant fragment corresponding to Arabidopsis thaliana Arabidopsis thaliana L-ascorbate peroxidase 2 aa 4-250.
    Sequence:

    KSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTK TGGPFGTIRHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGV VAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFGRMGLND KDIVALSGGHTLGRCHKERSGFEGAWTPNPLIFDNSYFKEILSGEKEGLL QLPTDKALLDDPLFLPFVEKYAADEDAFFEDYTEAHLKLSELGFADK


    Database link: Q1PER6

Properties

Applications

Our Abpromise guarantee covers the use of ab192946 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/600. Predicted molecular weight: 28 kDa.

References

ab192946 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192946.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up