Overview

  • Product name
  • Description
    Mouse polyclonal to l-Myc
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human l-Myc aa 1-206.
    Sequence:

    MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPG AGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFS ARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNPAPAAPCPLGE PKTQACSGSESPSDSGKDLPEPSKRGPPHGWPKLCPCLRSGIGSSQALGP SPPLFG


    Database link: NP_005367.2

Properties

Applications

Our Abpromise guarantee covers the use of ab167315 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 22 kDa.

Target

  • Sequence similarities
    Contains 1 bHLH (basic helix-loop-helix) domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • bHLHe38 antibody
    • Class E basic helix-loop-helix protein 38 antibody
    • l myc 1 proto oncogene antibody
    • L myc 1 proto-oncogene protein antibody
    • l myc protein antibody
    • LMYC antibody
    • Myc related gene from lung cancer antibody
    • MYCL 1 antibody
    • MYCL antibody
    • MYCL1 antibody
    • MYCL1_HUMAN antibody
    • oncogene lmyc antibody
    • Protein L-Myc-1 antibody
    • v myc avian myelocytomatosis viral oncogene homolog 1 lung carcinoma derived antibody
    see all

Images

  • All lanes : Anti-l-Myc antibody (ab167315) at 1 µg/ml

    Lane 1 : l-Myc-transfected 293T cell line lysate
    Lane 2 : Non-transfected lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 22 kDa

References

This product has been referenced in:
  • Suzuki K  et al. Antimyeloma activity of bromodomain inhibitors on the human myeloma cell line U266 by downregulation of MYCL. Anticancer Drugs 27:756-65 (2016). WB ; Human . Read more (PubMed: 27276402) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167315.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up