Overview

  • Product nameAnti-L2 antibody
    See all L2 primary antibodies
  • Description
    Mouse polyclonal to L2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Fusion protein:

    EDAPLRARPAAASPRAEPWLSQPASGSAYATPGAYGDIRPSAASWVGSRG LAYPARPAQLRRRASVRGSSEEDEDARTPDRATQGPGLAARRWWAASPAP

    , corresponding to amino acids 70/169 of Human L2

  • General notesProduced from outbred CD1 mice


    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage bufferConstituents: 50% Glycerol
  • PurityWhole antiserum
  • Primary antibody notesThis antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab22026 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 57 kDa.

This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.

Target

  • FunctionInvolved in nuclear structure organization.
  • Tissue specificityUbiquitously expressed.
  • Sequence similaritiesContains 1 LEM domain.
  • Cellular localizationNucleus inner membrane. Lamina-associated protein residing in the inner nuclear membrane (INM). Localized exclusively to the nuclear envelope, giving rise to a typical rim-like staining of the nuclear periphery.
  • Information by UniProt
  • Database links
  • Alternative names
    • BC026588 antibody
    • dJ482C21.1 antibody
    • hLEM2 antibody
    • Hypothetical protein FLJ90478 antibody
    • Hypothetical protein LEMD2 antibody
    • LEM domain containing 2 antibody
    • LEM domain-containing protein 2 antibody
    • Lem2 antibody
    • Lemd2 antibody
    • LEMD2_HUMAN antibody
    • MGC112806 antibody
    • MGC37253 antibody
    • NET25 antibody
    • OTTHUMP00000016218 antibody
    • OTTHUMP00000039610 2 antibody
    see all

Anti-L2 antibody images

  • All lanes : Anti-L2 antibody (ab22026) at 1/1000 dilution

    Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a negative control fusion protein with an irrelevant antigen at 20 ug
    Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the antigen fusion protein at 20 ug

    Secondary
    Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 1/5000 dilution

    Predicted band size : 57 kDa

References for Anti-L2 antibody (ab22026)

ab22026 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab22026.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"