
  • Product nameAnti-L2 antibody
    See all L2 primary antibodies
  • Description
    Rabbit polyclonal to L2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 454-503 (RRRMKRVWDRAVEFLASNESRIQTESHRVAGEDMLVWRWTKPSSFSDSE R) of Human L2 (NP_851853).

  • Positive control
    • Fetal Heart Lysate



Our Abpromise guarantee covers the use of ab89866 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 57 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • FunctionInvolved in nuclear structure organization.
  • Tissue specificityUbiquitously expressed.
  • Sequence similaritiesContains 1 LEM domain.
  • Cellular localizationNucleus inner membrane. Lamina-associated protein residing in the inner nuclear membrane (INM). Localized exclusively to the nuclear envelope, giving rise to a typical rim-like staining of the nuclear periphery.
  • Information by UniProt
  • Database links
  • Alternative names
    • BC026588 antibody
    • dJ482C21.1 antibody
    • hLEM2 antibody
    • Hypothetical protein FLJ90478 antibody
    • Hypothetical protein LEMD2 antibody
    • LEM domain containing 2 antibody
    • LEM domain-containing protein 2 antibody
    • Lem2 antibody
    • Lemd2 antibody
    • LEMD2_HUMAN antibody
    • MGC112806 antibody
    • MGC37253 antibody
    • NET25 antibody
    • OTTHUMP00000016218 antibody
    • OTTHUMP00000039610 2 antibody
    see all

Anti-L2 antibody images

References for Anti-L2 antibody (ab89866)

ab89866 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab89866.
Please use the links above to contact us or submit feedback about this product.