Overview

  • Product nameAnti-L3MBTL4 antibody
    See all L3MBTL4 primary antibodies
  • Description
    Rabbit polyclonal to L3MBTL4
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 36-85 (

    STTPLSHVPSAAAQGAWSWEWYLKEQKAVAAPVELFSKDQSFPEHENGFQ

    ) of Human L3MBTL4, NP_775735.

  • Positive control
    • 293T cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab85576 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 71 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceL3MBTL4 contains 3 MBT repeats and 1 SAM (sterile alpha motif) domain. The exact function of L3MBTL4 remains unknown.
  • Cellular localizationNucleus
  • Database links
  • Alternative names
    • 3bt-like 4 antibody
    • A730037L19Rik antibody
    • D930040M24Rik antibody
    • FLJ35936 antibody
    • H-l(3)mbt-like protein antibody
    • HsT1031 antibody
    • l(3)mbt like 4 (Drosophila) antibody
    • l(3)mbt like 4 antibody
    • l(3)mbt-like 4 (Drosophila) antibody
    • l(3)mbt-like 4 antibody
    • L(3)mbt-like 4 protein antibody
    • L3mbtl4 antibody
    • Lethal (3) malignant brain tumor-like 4 protein antibody
    • Lethal(3)malignant brain tumor-like protein 4 antibody
    see all

Anti-L3MBTL4 antibody images

  • Anti-L3MBTL4 antibody (ab85576) at 1 µg/ml (in 5% skim milk / PBS buffer) + 293T cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 71 kDa
    Observed band size : 85 kDa (why is the actual band size different from the predicted?)

References for Anti-L3MBTL4 antibody (ab85576)

ab85576 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85576.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"