
  • Product nameAnti-LAP3 antibody
    See all LAP3 primary antibodies
  • Description
    Rabbit polyclonal to LAP3
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 71-120 (LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQE NWHEGKEN) of Human LAP3 (NP_056991).

  • Positive control
    • Human fetal heart lysate.



Our Abpromise guarantee covers the use of ab98847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 56 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-LAP3 antibody images

  • Anti-LAP3 antibody (ab98847) at 1 µg/ml + Human fetal heart lysate at 10 µg

    Predicted band size : 56 kDa

References for Anti-LAP3 antibody (ab98847)

ab98847 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98847.
Please use the links above to contact us or submit feedback about this product.