Overview

  • Product name
    Anti-LARGE antibody [LARGE-02]
    See all LARGE primary antibodies
  • Description
    Mouse monoclonal [LARGE-02] to LARGE
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, Flow Cytmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Chicken
  • Immunogen

    Recombinant fragment corresponding to Human LARGE aa 35-142.
    Sequence:

    EDGKPVSLSPLESQAHSPRYTASSQRERESLEVRMREVEEENRALRRQLS LAQGRAPSHRRGNHSKTYSMEEGTGDSENLRAGIVAGNSSECGQQPVVEK CETIHVAI


    Database link: O95461

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.40
    Preservative: 0.0975% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity
    >95% by SDS-PAGE
  • Purification notes
    Purified from hybridoma culture supernatant by protein-A affinity chromatography.
  • Clonality
    Monoclonal
  • Clone number
    LARGE-02
  • Isotype
    IgG2b
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab191113 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 88 kDa.
Flow Cyt Use at an assay dependent concentration.

ab170192 - Mouse monoclonal IgG2b, is suitable for use as an isotype control with this antibody.

 

Target

  • Function
    Glycosyltransferase which participates in glycosylation of alpha-dystroglycan. May carry out the synthesis of glycoprotein and glycosphingolipid sugar chains. May be involved in the addition of a repeated disaccharide unit.
  • Tissue specificity
    Ubiquitous. Highest expression in heart, brain and skeletal muscle.
  • Pathway
    Protein modification; protein glycosylation.
  • Involvement in disease
    Muscular dystrophy-dystroglycanopathy congenital with mental retardation B6
    Muscular dystrophy-dystroglycanopathy congenital with brain and eye anomalies A6
  • Sequence similarities
    Belongs to the glycosyltransferase 8 family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Acetylglucosaminyltransferase like protein antibody
    • Acetylglucosaminyltransferase-like 1A antibody
    • Acetylglucosaminyltransferase-like protein antibody
    • Glycosyltransferase-like protein LARGE1 antibody
    • KIAA0609 antibody
    • Large antibody
    • LARGE_HUMAN antibody
    • LARGE1 antibody
    • Like acetylglucosaminyltransferase antibody
    • Like glycosyltransferase antibody
    • MDC1D antibody
    • MDDGA6 antibody
    • MDDGB6 antibody
    see all

Images

  • All lanes : Anti-LARGE antibody [LARGE-02] (ab191113)

    Lane 1 : Transfected HEK293 cell lysate
    Lane 2 : Non-transfected HEK293 cell lysate

    Predicted band size: 88 kDa

References

ab191113 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191113.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up