Overview

  • Product nameAnti-LASP1 antibody
    See all LASP1 primary antibodies
  • Description
    Rabbit polyclonal to LASP1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within amino acids 110-160 (

    IKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQ

    ) of Human LASP1 according to NP_006139.

  • Positive control
    • MCF7 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab104707 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 30 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-LASP1 antibody images

  • Anti-LASP1 antibody (ab104707) at 1 µg/ml + MCF7 cell lysate at 10 µg

    Predicted band size : 30 kDa

References for Anti-LASP1 antibody (ab104707)

ab104707 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104707.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"