Overview

  • Product nameAnti-LAX1 antibody
    See all LAX1 primary antibodies
  • Description
    Rabbit polyclonal to LAX1
  • Tested applicationsSuitable for: ELISA, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within amino acids 216-265 (

    LFVLPSTQKLEFTEERDEGCGDAGDCTSLYSPGAEDSDSLSNGEGSSQIS

    ) of Human LAX1 (NP_060243)

  • Positive control
    • HeLa cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab82785 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/12500.

WB Use a concentration of 1 µg/ml. Predicted molecular weight: 44 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceLAX1 negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells and BCR (B-cell antigen receptor)-mediated signaling in B-cells.
  • Cellular localizationCell Membrane; Single-pass type III membrane protein.
  • Database links
  • Alternative names
    • FLJ20340 antibody
    • LAT like membrane associated protein antibody
    • LAX antibody
    • Linker for activation of X cells antibody
    • Lymphocyte transmembrane adaptor 1 antibody
    • Membrane associated adapter protein LAX antibody
    • OTTHUMP00000034094 antibody
    see all

Anti-LAX1 antibody images

  • Anti-LAX1 antibody (ab82785) at 1 µg/ml + HeLa cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/5000 dilution

    Predicted band size : 44 kDa
    Observed band size : 44 kDa

References for Anti-LAX1 antibody (ab82785)

ab82785 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab82785.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"