Overview

  • Product nameAnti-LBX1 antibody
    See all LBX1 primary antibodies
  • Description
    Rabbit polyclonal to LBX1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human, Zebrafish
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Xenopus laevis
  • Immunogen

    Synthetic peptide corresponding to a region of Human LBX1 within internal sequence amino acids 72-121 (

    PLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQT

    ) (NP_006553)

  • Positive control
    • Human fetal thymus lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab90839 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 30 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-LBX1 antibody images



  • Predicted band size : 30 kDa
    Western blot analysis of OVCAR-3 cell lysate labeling LBX1 with ab90839 at 1.0µg/ml.
  • Anti-LBX1 antibody (ab90839) at 1 µg/ml + Human fetal thymus lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 30 kDa


  • Predicted band size : 30 kDa
    Western blot analysis of Human fetal lung tissue lysate labeling LBX1 with ab90839 at 1.0µg/ml.

References for Anti-LBX1 antibody (ab90839)

This product has been referenced in:

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab90839.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"