
  • Product name
  • Description
    Rabbit polyclonal to LC3C
  • Host species
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide conjugated to KLH, corresponding to amino acids 1-30 (MPPPQKIPSVRPFKQRKSLAIRQEEVAGIR) of Human LC3C (UniProt ID: Q9BXW4).

  • Positive control
    • WB: 293, Ramos, HeLa, HepG2, T47D, and Jurkat cell lysates.
      IHC: Human cancer tissue



Our Abpromise guarantee covers the use of ab168813 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/500. Predicted molecular weight: 17 kDa.
IHC-P 1/50 - 1/100. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.


  • Function
    Probably involved in formation of autophagosomal vacuoles (autophagosomes).
  • Tissue specificity
    Most abundant in placenta, lung and ovary.
  • Sequence similarities
    Belongs to the MAP1 LC3 family.
  • Post-translational
    The precursor molecule is cleaved by APG4B/ATG4B to form the cytosolic form, LC3-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, LC3-II.
  • Cellular localization
    Cytoplasm > cytoskeleton. Endomembrane system. Cytoplasmic vesicle > autophagosome membrane. LC3-II binds to the autophagic membranes.
  • Information by UniProt
  • Database links
  • Alternative names
    • ATG8J antibody
    • Autophagy-related protein LC3 C antibody
    • Autophagy-related ubiquitin-like modifier LC3 C antibody
    • LC3 like protein 2 antibody
    • MAP1 light chain 3 like protein 2 antibody
    • MAP1 light chain 3 like protein 3 antibody
    • MAP1 light chain 3-like protein 3 antibody
    • MAP1A/MAP1B LC3 C antibody
    • MAP1A/MAP1B light chain 3 C antibody
    • MAP1LC3C antibody
    • Microtubule-associated protein 1 light chain 3 gamma antibody
    • Microtubule-associated proteins 1A/1B light chain 3C antibody
    • MLP3C_HUMAN antibody
    see all


  • All lanes : Anti-LC3C antibody (ab168813) at 1/100 dilution

    Lane 1 : 293 lysate
    Lane 2 : Ramos lysate
    Lane 3 : HeLa lysate
    Lane 4 : HepG2 lysate
    Lane 5 : T47D lysate
    Lane 6 : Jurkat tissue lysate

    Lysates/proteins at 12.5 µg per lane.

    Predicted band size: 17 kDa

  • Immunohistochemistry analysis of formalin-fixed and paraffin-embedded Human breast carcinoma tissue labeling LC3C with ab168813 at 1/50.


This product has been referenced in:
  • Liu X  et al. The BEACH-containing protein WDR81 coordinates p62 and LC3C to promote aggrephagy. J Cell Biol 216:1301-1320 (2017). Read more (PubMed: 28404643) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168813.
Please use the links above to contact us or submit feedback about this product.


Sign up