Overview

  • Product nameAnti-LCN12 antibody
    See all LCN12 primary antibodies
  • Description
    Rabbit polyclonal to LCN12
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    A synthetic peptide corresponding to a region within the N terminal amino acids 36-85 (

    GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG

    ) of Human LCN12, NP_848631. The immunogen sequence is present in both Q6JVE5 and Q8IW14.

  • Positive control
    • Human fetal heart lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab85430 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 39 kDa (predicted molecular weight: 39 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionBinds all-trans retinoic acid and may act as a retinoid carrier protein within the epididymis. May play a role in male fertility.
  • Sequence similaritiesBelongs to the calycin superfamily. Lipocalin family.
  • Cellular localizationSecreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Epididymal-specific lipocalin-12 antibody
    • LCN12 antibody
    • LCN12_HUMAN antibody
    • Lipocalcin 12 antibody
    • Lipocalin 12 antibody
    • MGC34753 antibody
    • MGC48935 antibody
    see all

Anti-LCN12 antibody images

  • Anti-LCN12 antibody (ab85430) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal heart lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 39 kDa
    Observed band size : 39 kDa

References for Anti-LCN12 antibody (ab85430)

ab85430 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85430.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"