Overview

  • Product nameAnti-LDHAL6A antibody
    See all LDHAL6A primary antibodies
  • Description
    Rabbit polyclonal to LDHAL6A
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Cat, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 185-234 (CHGLILGEHGDSSVPVWSGVNIAGVPLKDLNPDIGTDKDPEQWENVHKK V) of Human LDHAL6A (NP_659409).

  • Positive control
    • HepG2 cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab123086 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 37 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionDisplays an lactate dehydrogenase activity. Significantly increases the transcriptional activity of JUN, when overexpressed.
  • Tissue specificityTestis-specific.
  • PathwayFermentation; pyruvate fermentation to lactate; (S)-lactate from pyruvate: step 1/1.
  • Sequence similaritiesBelongs to the LDH/MDH superfamily. LDH family.
  • Cellular localizationCytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • EC 1.1.1.27 antibody
    • L lactate dehydrogenase A like 6A antibody
    • L-lactate dehydrogenase A-like 6A antibody
    • Lactate dehydrogenase A-like 6A antibody
    • LDH6A antibody
    • LDH6A_HUMAN antibody
    • LDHAL6A antibody
    • MGC23940 antibody
    see all

Anti-LDHAL6A antibody images

  • Anti-LDHAL6A antibody (ab123086) at 1 µg/ml + HepG2 cell lysate at 10 µg

    Predicted band size : 37 kDa

References for Anti-LDHAL6A antibody (ab123086)

ab123086 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123086.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"