Overview

  • Product name
  • Description
    Rabbit polyclonal to LDHD
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 432 - 481 (

    LVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEVG

    ) of Human LDHD (NP_705690)

  • Positive control
    • Fetal heart lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab87741 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 55 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance
    LDHD belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. D-lactate and D-glycerate dehydrogenase activities have been found in a similar protein in yeast. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
  • Cellular localization
    Mitochondrial
  • Database links
  • Alternative names
    • D lactate dehydrogenase antibody
    • DLD antibody
    • Lactate dehydrogenase D antibody
    • MGC57726 antibody
    • Probable D lactate dehydrogenase mitochondrial antibody
    see all

Images

  • Anti-LDHD antibody (ab87741) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal heart lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 55 kDa

References

ab87741 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab87741.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up