Overview

  • Product nameAnti-LDHD antibody
    See all LDHD primary antibodies
  • Description
    Rabbit polyclonal to LDHD
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 432 - 481 (

    LVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEVG

    ) of Human LDHD (NP_705690)

  • Positive control
    • Fetal heart lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab87741 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 55 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceLDHD belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. D-lactate and D-glycerate dehydrogenase activities have been found in a similar protein in yeast. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
  • Cellular localizationMitochondrial
  • Database links
  • Alternative names
    • D lactate dehydrogenase antibody
    • DLD antibody
    • Lactate dehydrogenase D antibody
    • MGC57726 antibody
    • Probable D lactate dehydrogenase mitochondrial antibody
    see all

Anti-LDHD antibody images

  • Anti-LDHD antibody (ab87741) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal heart lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 55 kDa

References for Anti-LDHD antibody (ab87741)

ab87741 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab87741.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"