Anti-Leu + Met Enkephalin antibody (ab172085)

Overview

  • Product name
    Anti-Leu + Met Enkephalin antibody
    See all Leu + Met Enkephalin primary antibodies
  • Description
    Mouse polyclonal to Leu + Met Enkephalin
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Leu + Met Enkephalin aa 1-267.
    Sequence:

    MARFLTLCTWLLLLGPGLLATVRAECSQDCATCSYRLVRPADISFLACVM ECEGKLPSLKIWETCKELLQLSRPELPQDGTSTLRENSKPEESHLLAKRY GGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEEDDSL ANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLE DEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESY SKEVPEMEKRYGGFMRF


    Database link: AAH32505.1

  • Positive control
    • Leu + Met Enkephalin-transfected 293T cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Purity
    Whole antiserum
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab172085 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 31 kDa.

Target

Images

  • All lanes : Anti-Leu + Met Enkephalin antibody (ab172085) at 1/500 dilution

    Lane 1 : Leu + Met Enkephalin-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H+L)-HRP at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 31 kDa

References

ab172085 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172085.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up