Overview

  • Product name
    Anti-LexA DNA Binding Region antibody
    See all LexA DNA Binding Region primary antibodies
  • Description
    Rabbit polyclonal to LexA DNA Binding Region
  • Specificity
    Recognizes the LexA portion of bait fusion proteins used in the yeast two-hybrid system.
  • Tested applications
    Suitable for: WB, IPmore details
  • Immunogen

    Fusion protein (His-tag) corresponding to Escherichia coli LexA DNA Binding Region aa 1-202. Immunogen is identical for SwissProt: P0A7C2, P0A7C3, P0A7C4 His-tagged DNA binding domain of LexA protein corresponding to aa1-202
    Sequence:

    MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKAL ARKGVIEIVS GASRGIRLLQEEEEGLPLVGRVAAGEPLLAQQHIEGHY QVDPSLFKPNADFLLRVSGMSM KDIGIMDGDLLAVHKTQDVRNGQVVV ARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVD LRQQSFTIEGLAVG VIRNGDWL


    Database link: P0A7C2

  • Positive control
    • LexA-pRB-transfected yeast cells

Properties

Applications

Our Abpromise guarantee covers the use of ab14553 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.1 µg/ml. Predicted molecular weight: 49 kDa.

Detects LexA-pRB in LexA-pRB transfected yeast cells.

IP Use a concentration of 0.1 µg/ml.

5ug immunoprecipitates LexA-pRB from 500ug LexA-pRB transfected yeast cells.

Target

  • Relevance
    The LexA protein of Escherichia coli is a transcriptional repressor regulating approximately 20 genes, many of which are involved in DNA repair (SOS response). It binds with variable affinity to single, double, or even triple-operators via its amino-terminal domain that contains three alpha-helices spanning residues. This characteristic of LexA protein has been used to make efficient baits for two-hybrid studies.
  • Cellular localization
    Nuclear
  • Alternative names
    • ExrA antibody
    • Lex A antibody
    • LexA antibody
    • LexA repressor antibody
    • Spr antibody
    • Tsl antibody
    • UmuA antibody
    see all

References

This product has been referenced in:
  • Vilaboa N  et al. New inhibitor targeting human transcription factor HSF1: effects on the heat shock response and tumor cell survival. Nucleic Acids Res 45:5797-5817 (2017). WB ; Human . Read more (PubMed: 28369544) »
  • Rother S  et al. NF-?B-repressing factor phosphorylation regulates transcription elongation via its interactions with 5'?3' exoribonuclease 2 and negative elongation factor. FASEB J 30:174-85 (2016). Read more (PubMed: 26340924) »

See all 8 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab14553.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up