Overview

  • Product nameAnti-LexA DNA Binding Region antibody
    See all LexA DNA Binding Region primary antibodies
  • Description
    Rabbit polyclonal to LexA DNA Binding Region
  • SpecificityRecognizes the LexA portion of bait fusion proteins used in the yeast two-hybrid system.
  • Tested applicationsSuitable for: WB, IPmore details
  • Immunogen

    Fusion protein (His-tag) corresponding to Escherichia coli LexA DNA Binding Region aa 1-202. Immunogen is identical for SwissProt: P0A7C2, P0A7C3, P0A7C4 His-tagged DNA binding domain of LexA protein corresponding to aa1-202
    Sequence:

    MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKAL ARKGVIEIVS GASRGIRLLQEEEEGLPLVGRVAAGEPLLAQQHIEGHY QVDPSLFKPNADFLLRVSGMSM KDIGIMDGDLLAVHKTQDVRNGQVVV ARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVD LRQQSFTIEGLAVG VIRNGDWL


    Database link: P0A7C2

  • Positive control
    • LexA-pRB-transfected yeast cells

Properties

Applications

Our Abpromise guarantee covers the use of ab14553 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.1 µg/ml. Predicted molecular weight: 49 kDa.

Detects LexA-pRB in LexA-pRB transfected yeast cells.

IP Use a concentration of 0.1 µg/ml.

5ug immunoprecipitates LexA-pRB from 500ug LexA-pRB transfected yeast cells.

Target

  • RelevanceThe LexA protein of Escherichia coli is a transcriptional repressor regulating approximately 20 genes, many of which are involved in DNA repair (SOS response). It binds with variable affinity to single, double, or even triple-operators via its amino-terminal domain that contains three alpha-helices spanning residues. This characteristic of LexA protein has been used to make efficient baits for two-hybrid studies.
  • Cellular localizationNuclear
  • Alternative names
    • ExrA antibody
    • Lex A antibody
    • LexA antibody
    • LexA repressor antibody
    • Spr antibody
    • Tsl antibody
    • UmuA antibody
    see all

References for Anti-LexA DNA Binding Region antibody (ab14553)

This product has been referenced in:
  • Rother S  et al. NF-?B-repressing factor phosphorylation regulates transcription elongation via its interactions with 5'?3' exoribonuclease 2 and negative elongation factor. FASEB J 30:174-85 (2016). Read more (PubMed: 26340924) »
  • Alver RC  et al. The N-terminus of Mcm10 is important for interaction with the 9-1-1 clamp and in resistance to DNA damage. Nucleic Acids Res N/A:N/A (2014). WB . Read more (PubMed: 24972833) »

See all 6 Publications for this product

Product Wall

There are currently no Abreviews or Questions for ab14553.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"