Anti-LIM domain-binding protein 1-A antibody - C-terminal (ab191297)

Overview

  • Product name
    Anti-LIM domain-binding protein 1-A antibody - C-terminal
  • Description
    Rabbit polyclonal to LIM domain-binding protein 1-A - C-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Zebrafish
  • Immunogen

    Synthetic peptide within Zebrafish LIM domain-binding protein 1-A aa 336-368 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    DDEDSFNSSPTMGTNSPWNSKAPSSQQGKNDNP


    Database link: O73715

  • Positive control
    • Zebrafish muscle tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab191297 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 43 kDa.

Target

  • Function
    Binds to the LIM domain of a wide variety of LIM domain-containing transcription factors.
  • Tissue specificity
    Expressed ubiquitously in the embryo and adult.
  • Sequence similarities
    Belongs to the LDB family.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • LDB-1-A antibody
    • LDB-4 antibody
    • ldb1a antibody
    • LDB1A_DANRE antibody
    • LIM domain-binding protein 1-A antibody
    • LIM domain-binding protein 4 antibody
    • zLdb4 antibody
    see all

Images

  • Anti-LIM domain-binding protein 1-A antibody - C-terminal (ab191297) at 1/1000 dilution + Zebra fish muscle tissue lysate at 35 µg

    Secondary
    goat anti-rabbit IgG H&L(HRP) at 1/1000 dilution

    Predicted band size : 43 kDa

References

ab191297 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191297.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up