
  • Product nameAnti-LIMD1 antibody
    See all LIMD1 primary antibodies
  • Description
    Rabbit polyclonal to LIMD1
  • Tested applicationsSuitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 1-50 (DKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFAT K) of Human LIMD1, CAC35917

  • Positive control
    • HepG2 cell lysate.



Our Abpromise guarantee covers the use of ab81186 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml.
WB Use a concentration of 1 µg/ml. Detects a band of approximately 56 kDa (predicted molecular weight: 56 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-LIMD1 antibody images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human placenta tissue labelling LIMD1 with ab81186.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human placenta tissue labelling LIMD1 with ab81186.

  • Anti-LIMD1 antibody (ab81186) at 1 µg/ml + HepG2 cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 56 kDa
    Observed band size : 56 kDa

References for Anti-LIMD1 antibody (ab81186)

ab81186 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81186.
Please use the links above to contact us or submit feedback about this product.