Overview

  • Product name
  • Description
    Rabbit polyclonal to LINGO4
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Guinea pig, Cow, Cat, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within amino acids 468-517 (TLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNI T) of human LINGO4 (NP_001004432).

  • Positive control
    • 293T cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab84662 is purified by peptide affinity chromatography method.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab84662 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 64 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance
    The exact function of LINGO4 remains unknown.
  • Cellular localization
    Membrane; Single pass type I membrane protein
  • Database links
  • Alternative names
    • DAAT9248 antibody
    • Leucine rich repeat and Ig domain containing 4 antibody
    • Leucine rich repeat and immunoglobulin like domain containing nogo receptor interacting protein 4 antibody
    • leucine rich repeat neuronal 6D antibody
    • Leucine rich repeat neuronal protein 6D antibody
    • Leucine-rich repeat- and Ig like domain-containing nogo receptor-interacting protein 4 antibody
    • LRRN6D antibody
    • PRO34002 antibody
    see all

Anti-LINGO4 antibody images

  • Anti-LINGO4 antibody (ab84662) at 1 µg/ml (in 5% skim milk / PBS buffer) + 293T cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 64 kDa
    Observed band size : 64 kDa

References for Anti-LINGO4 antibody (ab84662)

ab84662 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84662.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up