Overview

  • Product name
  • Description
    Rabbit polyclonal to LIPC
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 303-352 (GDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSKRLFLVTRAQSPFKV Y) of Human LIPC (NP_000227).

  • Positive control
    • Human fetal liver lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab123088 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 56 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Hepatic lipase has the capacity to catalyze hydrolysis of phospholipids, mono-, di-, and triglycerides, and acyl-CoA thioesters. It is an important enzyme in HDL metabolism. Hepatic lipase binds heparin.
  • Involvement in disease
    Defects in LIPC are the cause of hepatic lipase deficiency (HL deficiency) [MIM:151670].
  • Sequence similarities
    Belongs to the AB hydrolase superfamily. Lipase family.
    Contains 1 PLAT domain.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • HDLCQ12 antibody
    • Hepatic lipase antibody
    • Hepatic triacylglycerol lipase antibody
    • HL antibody
    • HTGL antibody
    • Lipase member C antibody
    • lipC antibody
    • LIPC_HUMAN antibody
    • LIPH antibody
    see all

Images

  • Anti-LIPC antibody (ab123088) at 1 µg/ml + Human fetal liver lysate at 10 µg

    Predicted band size : 56 kDa

References

ab123088 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab123088.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up