
  • Product name
  • Description
    Rabbit polyclonal to LIPC
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 303-352 (GDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSKRLFLVTRAQSPFKV Y) of Human LIPC (NP_000227).

  • Positive control
    • Human fetal liver lysate



Our Abpromise guarantee covers the use of ab123088 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 56 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Function
    Hepatic lipase has the capacity to catalyze hydrolysis of phospholipids, mono-, di-, and triglycerides, and acyl-CoA thioesters. It is an important enzyme in HDL metabolism. Hepatic lipase binds heparin.
  • Involvement in disease
    Defects in LIPC are the cause of hepatic lipase deficiency (HL deficiency) [MIM:151670].
  • Sequence similarities
    Belongs to the AB hydrolase superfamily. Lipase family.
    Contains 1 PLAT domain.
  • Cellular localization
  • Information by UniProt
  • Database links
  • Alternative names
    • HDLCQ12 antibody
    • Hepatic lipase antibody
    • Hepatic triacylglycerol lipase antibody
    • HL antibody
    • HTGL antibody
    • Lipase member C antibody
    • lipC antibody
    • LIPC_HUMAN antibody
    • LIPH antibody
    see all

Anti-LIPC antibody images

  • Anti-LIPC antibody (ab123088) at 1 µg/ml + Human fetal liver lysate at 10 µg

    Predicted band size : 56 kDa

References for Anti-LIPC antibody (ab123088)

ab123088 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123088.
Please use the links above to contact us or submit feedback about this product.


Sign up