Overview

  • Product name
  • Description
    Rabbit polyclonal to LIPT2
  • Tested applications
    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    antigen sequence: CAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSKELQRH VTVEEVMPPFLVA FKEIYKCTLISEDS, corresponding to amino acids 153-229 of Human LIPT2. (A6NK58).

  • Positive control
    • Human rectum tissue

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at -20ºC.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab122641 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

Target

  • Function
    Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate.
  • Pathway
    Protein modification; protein lipoylation via endogenous pathway; protein N(6)-(lipoyl)lysine from octanoyl-[acyl-carrier-protein]: step 1/2.
  • Sequence similarities
    Belongs to the lipB family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt
  • Database links
  • Alternative names
    • EC 2.3.1.181 antibody
    • FCT2 antibody
    • Lipoate-protein ligase B antibody
    • Lipoyl(octanoyl) transferase 2 (putative) antibody
    • Lipoyl/octanoyl transferase antibody
    • Lipt2 antibody
    • LIPT2_HUMAN antibody
    • mitochondrial antibody
    • Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase antibody
    • OTTHUMP00000230589 antibody
    • OTTHUMP00000230590 antibody
    • OTTHUMP00000230591 antibody
    • Putative lipoyltransferase 2 antibody
    • Putative lipoyltransferase 2, mitochondrial antibody
    • Putative octanoyltransferase, mitochondrial antibody
    • SLC22A16 antibody
    see all

Images

  • Immunofluorescent staining of Human cell line U-2 OS shows positivity in vesicles. Recommended concentration of ab122641 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab122641, at 1/20, staining LIPT2 in paraffin embedded Human rectum by Immunohistochemistry.

References

ab122641 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab122641.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up