Overview

  • Product nameAnti-LIPT2 antibody
    See all LIPT2 primary antibodies
  • Description
    Rabbit polyclonal to LIPT2
  • Tested applicationsSuitable for: IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    antigen sequence: CAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSKELQRH VTVEEVMPPFLVA FKEIYKCTLISEDS, corresponding to amino acids 153-229 of Human LIPT2. (A6NK58).

  • Positive control
    • Human rectum tissue

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at -20ºC.
  • Storage bufferpH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab122641 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

Target

  • FunctionCatalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate.
  • PathwayProtein modification; protein lipoylation via endogenous pathway; protein N(6)-(lipoyl)lysine from octanoyl-[acyl-carrier-protein]: step 1/2.
  • Sequence similaritiesBelongs to the lipB family.
  • Cellular localizationMitochondrion.
  • Information by UniProt
  • Database links
  • Alternative names
    • EC 2.3.1.181 antibody
    • FCT2 antibody
    • Lipoate-protein ligase B antibody
    • Lipoyl(octanoyl) transferase 2 (putative) antibody
    • Lipoyl/octanoyl transferase antibody
    • Lipt2 antibody
    • LIPT2_HUMAN antibody
    • mitochondrial antibody
    • Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase antibody
    • OTTHUMP00000230589 antibody
    • OTTHUMP00000230590 antibody
    • OTTHUMP00000230591 antibody
    • Putative lipoyltransferase 2 antibody
    • Putative lipoyltransferase 2, mitochondrial antibody
    • Putative octanoyltransferase, mitochondrial antibody
    • SLC22A16 antibody
    see all

Anti-LIPT2 antibody images

  • Immunofluorescent staining of Human cell line U-2 OS shows positivity in vesicles. Recommended concentration of ab122641 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab122641, at 1/20, staining LIPT2 in paraffin embedded Human rectum by Immunohistochemistry.

References for Anti-LIPT2 antibody (ab122641)

ab122641 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122641.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"