Overview

  • Product name
    Anti-LKB1 antibody - C-terminal
    See all LKB1 primary antibodies
  • Description
    Rabbit polyclonal to LKB1 - C-terminal
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human LKB1 aa 300-430 (C terminal).
    Sequence:

    IRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADE DEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQ LSTKSRAEGRAPNPARKACS ASSKIRRLSAC


    Database link: Q15831

  • Positive control
    • MCF-7 and HepG2 extract

Properties

Applications

Our Abpromise guarantee covers the use of ab185734 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 49 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

ICC/IF Use at an assay dependent concentration.

Target

  • Function
    Essential role in G1 cell cycle arrest. Phosphorylates and activates members of the AMPK-related subfamily of protein kinases. Tumor suppressor.
  • Tissue specificity
    Ubiquitously expressed. Strongest expression in testis and fetal liver.
  • Involvement in disease
    Defects in STK11 are a cause of Peutz-Jeghers syndrome (PJS) [MIM:175200]. PJS is a rare hereditary disease in which there is predisposition to benign and malignant tumors of many organ systems. PJS is an autosomal dominant disorder characterized by melanocytic macules of the lips, multiple gastrointestinal hamartomatous polyps and an increased risk for various neoplasms, including gastrointestinal cancer.
    Defects in STK11 have been associated with testicular tumors (TEST) [MIM:273300]. A common solid malignancy in males. Germ cell tumors of the testis constitute 95% of all testicular neoplasms.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. LKB1 subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylated by a cAMP-dependent protein kinase.
  • Cellular localization
    Nucleus. Cytoplasm. Relocates to the cytoplasm when bound to CAB39 and STRAD or CAB39 and ALS2CR2.
  • Information by UniProt
  • Database links
  • Alternative names
    • hLKB1 antibody
    • Liver kinase B1 antibody
    • LKB1 antibody
    • PJS antibody
    • Polarization related protein LKB1 antibody
    • Renal carcinoma antigen NY-REN-19 antibody
    • Serine/Threonine Kinase 11 antibody
    • Serine/threonine protein kinase 11 antibody
    • Serine/threonine protein kinase LKB1 antibody
    • Serine/threonine protein kinase STK11 antibody
    • Serine/threonine-protein kinase 11 antibody
    • Serine/threonine-protein kinase LKB1 antibody
    • Serine/threonine-protein kinase XEEK1 antibody
    • Stk11 antibody
    • STK11_HUMAN antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab185734. Blue DAPI for nuclear staining.
  • All lanes : Anti-LKB1 antibody - C-terminal (ab185734) at 1/500 dilution

    Lane 1 : MCF-7 extract
    Lane 2 : HepG2 extract


    Predicted band size : 49 kDa

References

ab185734 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185734.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up