
  • Product name
    Anti-LOC284009 antibody
  • Description
    Rabbit polyclonal to LOC284009
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 37-86 (IRCGRPAVVHIGGEGARWEKGARGRKEHRLRRSDLGSRPVPFLAQGIPD I) of Human LOC284009, NP_ 001020630

  • Positive control
    • Fetal lung lysate.


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab81361 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 17 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/62500.


  • Relevance
    The exact function of LOC284009 remains unknown.
  • Database links
  • Alternative names
    • hypothetical protein LOC 284009 antibody
    • LOC 284009 antibody
    • LOC284009 antibody
    • MGC 138239 antibody
    • MGC138239 antibody
    see all

Anti-LOC284009 antibody images

  • Anti-LOC284009 antibody (ab81361) at 1 µg/ml + Fetal lung lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 17 kDa
    Observed band size : 20 kDa (why is the actual band size different from the predicted?)

References for Anti-LOC284009 antibody (ab81361)

ab81361 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81361.
Please use the links above to contact us or submit feedback about this product.


Sign up