Overview

  • Product nameAnti-LOC650515 antibody
  • Description
    Rabbit polyclonal to LOC650515
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within C-terminal amino acids 246-295

    VQTVLPLVMDTELLGQRLKPQGPCCPSRSFFSESQGKSFRVAPPSGQKLI

    of Human LOC650515 (XP_944700).

  • Positive control
    • 721_B Cell Lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab105844 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 µg/ml. Predicted molecular weight: 39 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Database links
  • Alternative names
    • Asparagine-linked glycosylation 1 homolog pseudogene antibody
    • LOC100132066 asparagine-linked glycosylation 1 homolog pseudogene antibody

Anti-LOC650515 antibody images

  • Anti-LOC650515 antibody (ab105844) at 0.5 µg/ml + 721_B Cell Lysate at 10 µg

    Predicted band size : 39 kDa

References for Anti-LOC650515 antibody (ab105844)

ab105844 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105844.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"