Overview

  • Product nameAnti-LRDD antibody
    See all LRDD primary antibodies
  • Description
    Rabbit polyclonal to LRDD
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 143-192 (

    RLQGNPLGEASPDAPSSPVAALIPEMPRLFLTSDLDSFPVTPQGCSVTLA

    ) of Human LRDD isoform 3.

  • Positive control
    • Human Fetal Liver Lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab99149 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 83 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceThe death domain (DD) containing protein PIDD is a p53 target gene in an erythroleukemia cell line that undergoes G1 phase arrest and subsequent apoptosis after p53 expression. Independently, PIDD was also described as a DD-containing protein with unknown function. The N-terminal region of PIDD contains seven leucine-rich repeats (LRRs), a protein interaction motif found in various proteins with diverse functions, followed by two ZU-5 domains and a C-terminal DD. PIDD forms a complex with caspase-2 and the adaptor protein RAIDD. Increased PIDD expression results in spontaneous activation of caspase-2 and sensitization to apoptosis by genotoxic stimuli, via interaction with caspase-2 and CRADD/RAIDD. PIDD also promotes apoptosis downstream of p53 as component of the DNA damage/stress response pathway that connects p53/TP53 to apoptosis. PIDD has also been shown to interact with NEMO/IKBKG and RIP1 and enhance sumoylation and ubiquitination of NEMO/IKBKG, an important component for activation of the transcription factor NF-kappa-B.
  • Cellular localizationCytoplasm. Nucleus.
  • Database links
  • Alternative names
    • DKFZp434D229 antibody
    • Leucine rich repeats and death domain containing antibody
    • Leucine-rich repeats and death domain containing antibody
    • MGC16925 antibody
    • p53-induced protein with a death domain antibody
    • PIDD antibody
    see all

Anti-LRDD antibody images

  • Anti-LRDD antibody (ab99149) at 1 µg/ml + Human Fetal Liver Lysate at 10 µg

    Predicted band size : 83 kDa

References for Anti-LRDD antibody (ab99149)

ab99149 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99149.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"