Overview

  • Product nameAnti-LRRC52 antibody
    See all LRRC52 primary antibodies
  • Description
    Rabbit polyclonal to LRRC52
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Cow, Cat, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids

    QEVICTGKQLTEYPLDIPLNTRRLFLNENRITSLPAMHLGLLSDLVYLDC

    of Human LRRC52 (NP_001005214).

  • Positive control
    • PANC-1 cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab105423 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-LRRC52 antibody images

  • Anti-LRRC52 antibody (ab105423) at 1 µg/ml + PANC-1 cell lysate at 10 µg

    Predicted band size : 35 kDa

References for Anti-LRRC52 antibody (ab105423)

ab105423 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105423.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"