Overview

  • Product name
  • Description
    Mouse polyclonal to LRRFIP2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Full length protein corresponding to Human LRRFIP2 aa 1-400. Isoform 2 (NP_060194.1).
    Sequence:

    MGTPASGRKRTPVKDRFSAEDEALSNIAREAEARLAAKRAARAEARDIRM RELERQQKELDEKSDKQYAENYTRPSSRNSASATTPLSGNSSRRGSGDTS SLIDPDTSLSELRESLSEVEEKYKKAMVSNAQLDNEKNNLIYQVDTLKDV IEEQEEQMAEFYRENEEKSKELERQKHMCSVLQHKMEELKEGLRQRDELI EKHGLVIIPDGTPNGDVSHEPVAGAITVVSQEAAQVLESAGEGPLDVRLR KLAGEKEELLSQIRKLKLQLEEERQKCSRNDGTVGDLAGLQNGSDLQFIE MQRDANRQISEYKFKLSKAEQDITTLEQSISRLEGQVLRYKTAAENAEKV EDELKAEKRKLQRELRTALDKIEEMEMTNSHLAKRLEKMKANRTALLAQQ


    Database link: Q9Y608-2

  • Positive control
    • LRRFIP2 transfected 293T lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172367 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 45.4 kDa.

Target

  • Function
    May function as activator of the canonical Wnt signaling pathway, in association with DVL3, upstream of CTNNB1/beta-catenin.
  • Tissue specificity
    Ubiquitous with higher expression in heart and skeletal muscle.
  • Sequence similarities
    Belongs to the LRRFIP family.
  • Information by UniProt
  • Database links
  • Alternative names
    • 5133400F20Rik antibody
    • AI850587 antibody
    • DKFZp434H2035 antibody
    • FLJ20248 antibody
    • FLJ22683 antibody
    • FLJ58304 antibody
    • HUFI 2 antibody
    • Leucine rich repeat (in FLII) interacting protein 2 antibody
    • Leucine rich repeat flightless interacting protein 2 antibody
    • Leucine-rich repeat flightless-interacting protein 2 antibody
    • LRR FLII interacting protein 2 antibody
    • LRR FLII-interacting protein 2 antibody
    • LRRF2_HUMAN antibody
    • Lrrfip2 antibody
    see all

Images

  • All lanes : Anti-LRRFIP2 antibody (ab172367) at 1 µg/ml

    Lane 1 : LRRFIP2 transfected 293T lysate
    Lane 2 : Non-transfected 293T lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique

    Predicted band size : 45.4 kDa

References

ab172367 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172367.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up