Overview

  • Product name
  • Description
    Rabbit polyclonal to LRRTM1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 180 - 229 (

    IFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNFAHF

    ) of Human LRRTM1 (NP_849161)

  • Positive control
    • Placenta lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab87774 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 59 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    May play a role during the development of specific forebrain structures by influencing neuronal differentiation and connectivity, with a possible role in intracellular trafficking within axons.
  • Tissue specificity
    Predominantly expression in forebrain regions including thalamus and cerebral cortex.
  • Sequence similarities
    Belongs to the LRRTM family.
    Contains 9 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 LRRNT domain.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • 4632401D06Rik antibody
    • AW125451 antibody
    • FLJ32082 antibody
    • Leucine rich repeat transmembrane neuronal 1 antibody
    • Leucine rich repeat transmembrane neuronal 1 protein antibody
    • Leucine-rich repeat transmembrane neuronal protein 1 antibody
    • LRRT1_HUMAN antibody
    • LRRTM1 antibody
    • Lrrtm1 leucine rich repeat transmembrane neuronal 1 antibody
    • OTTHUMP00000194829 antibody
    see all

Images

  • Anti-LRRTM1 antibody (ab87774) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human placenta lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 59 kDa

References

ab87774 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab87774.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up