Overview

  • Product name
  • Description
    Mouse polyclonal to LST1
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human LST1 aa 1-118.
    Sequence:

    MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWPRAPQ SRNSTMHLCRGCQCPAVRDLTSGAETREAPRRIQELTMPALLRTNPPEHP RHLPQPRRVDRVPLWSSQ


    Database link: NP_009092.2

  • Positive control
    • LST1-transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172244 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 13 kDa.

Target

  • Function
    Possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation.
  • Tissue specificity
    Expressed in lung, tonsil, thymus, placenta, kidney, fetal spleen, fetal liver and brain.
  • Sequence similarities
    Belongs to the LST1 family.
  • Cellular localization
    Membrane. Golgi apparatus membrane. Endomembrane system. Also detected in a perinuclear region corresponding to the localization of the Golgi apparatus and throughout the cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • B144 antibody
    • B144 protein antibody
    • D6S49E antibody
    • Leucocyte specific transcript 1 antibody
    • Leukocyte-specific transcript 1 protein antibody
    • Liver Specific Transporter antibody
    • LIVTR antibody
    • LST 1 antibody
    • Lst1 antibody
    • LST1_HUMAN antibody
    • lymphocyte antigen 117 antibody
    • MGC119006 antibody
    • MGC119007 antibody
    • OTTHUMP00000029390 antibody
    • OTTHUMP00000029391 antibody
    • OTTHUMP00000029392 antibody
    • OTTHUMP00000029396 antibody
    • OTTHUMP00000029397 antibody
    • OTTHUMP00000029398 antibody
    • OTTHUMP00000038208 antibody
    • OTTHUMP00000038211 antibody
    • OTTHUMP00000038213 antibody
    • OTTHUMP00000038312 antibody
    • OTTHUMP00000038314 antibody
    • OTTHUMP00000038315 antibody
    • OTTHUMP00000038651 antibody
    • OTTHUMP00000038655 antibody
    • OTTHUMP00000038657 antibody
    • OTTHUMP00000166011 antibody
    • OTTHUMP00000166014 antibody
    • OTTHUMP00000166016 antibody
    • OTTHUMP00000166017 antibody
    • OTTHUMP00000166018 antibody
    • OTTHUMP00000166019 antibody
    • OTTHUMP00000215143 antibody
    • Protein B144 antibody
    see all

Images

  • All lanes : Anti-LST1 antibody (ab172244) at 1 µg/ml

    Lane 1 : LST1-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H+L)-HRP at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 13 kDa

References

ab172244 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172244.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up