Overview

  • Product name
  • Description
    Rabbit polyclonal to LY6E
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Ly-6A/E aa 1-131. (NP_002337.1)
    Sequence:

    MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVT VSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNF SAADGGLRASVTLLGAGLLLSLLPALLRFGP


    Database link: Q16553

  • Positive control
    • Ly-6A/E transfected lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab172021 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 14 kDa.

Target

  • Database links
  • Alternative names
    • Ly-6E antibody
    • Retinoic acid-induced gene E protein antibody
    • RIG-E antibody
    • SCA-2 antibody
    • Stem cell antigen 2 antibody
    • Thymic shared antigen 1 antibody
    • TSA-1 antibody
    see all

Images

  • All lanes : Anti-LY6E antibody (ab172021) at 1 µg/ml

    Lane 1 : LY6E transfected lysate
    Lane 2 : Non-transfected lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG (H+L), Peroxidase Conjugated at 1/7500 dilution

    Predicted band size: 14 kDa

References

ab172021 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172021.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up