Anti-Lysine decarboxylase, constitutive antibody (Biotin) (ab193351)

Overview

  • Product name
    Anti-Lysine decarboxylase, constitutive antibody (Biotin)
    See all Lysine decarboxylase, constitutive primary antibodies
  • Description
    Rabbit polyclonal to Lysine decarboxylase, constitutive (Biotin)
  • Host species
    Rabbit
  • Conjugation
    Biotin
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Escherichia coli
  • Immunogen

    Recombinant full length protein corresponding to Escherichia coli Lysine decarboxylase, constitutive aa 1-713.
    Sequence:

    MNIIAIMGPHGVFYKDEPIKELESALVAQGFQIIWPQNSVDLLKFIEHNP RICGVIFDWDEYSLDLCSDINQLNEYLPLYAFINTHSTMDVSVQDMRMAL WFFEYALGQAEDIAIRMRQYTDEYLDNITPPFTKALFTYVKERKYTFCTP GHMGGTAYQKSPVGCLFYDFFGGNTLKADVSISVTELGSLLDHTGPHLEA EEYIARTFGAEQSYIVTNGTSTSNKIVGMYAAPSGSTLLIDRNCHKSLAH LLMMNDVVPVWLKPTRNALGILGGIPRREFTRDSIEEKVAATTQAQWPVH AVITNSTYDGLLYNTDWIKQTLDVPSIHFDSAWVPYTHFHPIYQGKSGMS GERVAGKVIFETQSTHKMLAALSQASLIHIKGEYDEEAFNEAFMMHTTTS PSYPIVASVETAAAMLRGNPGKRLINRSVERALHFRKEVQRLREESDGWF FDIWQPPQVDEAECWPVAPGEQWHGFNDADADHMFLDPVKVTILTPGMDE QGNMSEEGIPAALVAKFLDERGIVVEKTGPYNLLFLFSIGIDKTKAMGLL RGLTEFKRSYDLNLRIKNMLPDLYAEDPDFYRNMRIQDLAQGIHKLIRKH DLPGLMLRAFDTLPEMIMTPHQAWQRQIKGEVETIALEQLVGRVSANMIL PYPPGVPLLMPGEMLTKESRTVLDFLLMLCSVGQHYPGFETDIHGAKQDE DGVYRVRVLKMAG


    Database link: P52095

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.
  • Storage buffer
    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab193351 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/50 - 1/100. Predicted molecular weight: 81 kDa.

Target

  • Relevance
    LDC is constitutively but weakly expressed under various conditions. Catalytic activity: L-lysine = cadaverine + CO2.
  • Database links
    • Alternative names
      • ldcC antibody
      • LDC antibody
      • ldcH antibody

    References

    ab193351 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab193351.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up