Overview

  • Product nameAnti-LYSMD4 antibody
    See all LYSMD4 primary antibodies
  • Description
    Rabbit polyclonal to LYSMD4
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 36-85 (

    RREQVTWCCCSGSWPRRTASTSWRCSMAANTFYFRPNGAGDTRQNLIPDF

    ) of Human LYSMD4 (NP_689662).

  • Positive control
    • HepG2 cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab87162 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 32 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceThe specific function of LYSMD4 is not yet known.
  • Cellular localizationMembrane; Single-pass membrane protein
  • Database links
  • Alternative names
    • FLJ33008 antibody
    • LysM putative peptidoglycan binding domain containing 4 antibody
    • MGC99501 antibody

Anti-LYSMD4 antibody images

  • Anti-LYSMD4 antibody (ab87162) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 32 kDa
    Observed band size : 32 kDa
    Additional bands at : 40 kDa,60 kDa. We are unsure as to the identity of these extra bands.

References for Anti-LYSMD4 antibody (ab87162)

ab87162 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab87162.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"