Anti-Macrophage Inflammatory Protein 1 beta antibody (ab25129)

Overview

  • Product name
    Anti-Macrophage Inflammatory Protein 1 beta antibody
    See all Macrophage Inflammatory Protein 1 beta primary antibodies
  • Description
    Rabbit polyclonal to Macrophage Inflammatory Protein 1 beta
  • Tested applications
    Suitable for: IP, ICC/IF, Neutralising, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat
  • Immunogen

    Synthetic peptide:

    MKLCVSAFSLLLLVAAFCDSVLSAPIGSDPPTSCCFSYTSRKIHRNFVMD YYETSSLCSQPAVVFLTKK

    , corresponding to N terminal amino acids 1 - 69 of Rat Macrophage Inflammatory Protein 1 beta

  • Positive control
    • ICC/IF: Raw264.7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab25129 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP 1/500.
ICC/IF Use a concentration of 5 µg/ml.
Neutralising Use at an assay dependent concentration.
WB 1/2000. Predicted molecular weight: 10 kDa.

Target

  • Function
    Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.
  • Sequence similarities
    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications
    N-terminal processed form MIP-1-beta(3-69) is produced by proteolytic cleavage after secretion from peripheral blood lymphocytes.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • MIP 1 beta antibody
    • Secreted protein G 26 antibody
    • ACT 2 antibody
    • ACT-2 antibody
    • ACT2 antibody
    • AT744.1 antibody
    • AT744.2 antibody
    • C C motif chemokine 4 antibody
    • C C motif chemokine 4 like antibody
    • C C motif chemokine ligand 4 like 1 antibody
    • C C motif chemokine ligand 4 like 2 antibody
    • CC chemokine ligand 4 antibody
    • CC chemokine ligand 4L1 antibody
    • CC chemokine ligand 4L1d2 antibody
    • CC chemokine ligand 4L2 antibody
    • CCL4 antibody
    • CCL4_HUMAN antibody
    • ccl4l 1 antibody
    • CCL4L antibody
    • CCL4L1 antibody
    • Chemokine (C C motif) ligand 4 antibody
    • Chemokine (C C motif) ligand 4 like 1 antibody
    • Chemokine (C C motif) ligand 4 like 1, telomeric antibody
    • Chemokine (C C motif) ligand 4 like 2 antibody
    • Chemokine CC Motif Ligand 4 antibody
    • G 26 antibody
    • G 26 T lymphocyte secreted protein antibody
    • G-26 T-lymphocyte-secreted protein antibody
    • HC21 antibody
    • Immune activation 2 antibody
    • LAG 1 antibody
    • LAG-1 antibody
    • LAG1 antibody
    • Lymphocyte activation gene 1 antibody
    • Lymphocyte activation gene 1 protein antibody
    • Macrophage inflammatory protein 1 beta antibody
    • Macrophage inflammatory protein 1-beta antibody
    • Macrophage inflammatory protein 1b2 antibody
    • MGC104418 antibody
    • MGC126025 antibody
    • MGC126026 antibody
    • MIP-1-beta antibody
    • MIP-1-beta(1-69) antibody
    • MIP-1-beta(3-69) antibody
    • MIP1 beta antibody
    • MIP1B antibody
    • MIP1B1 antibody
    • Monocyte adherence induced protein 5 alpha antibody
    • PAT 744 antibody
    • Protein H400 antibody
    • SCYA2 antibody
    • SCYA4 antibody
    • SCYA4L antibody
    • SCYA4L1 antibody
    • SCYA4L2 antibody
    • SCYQ4L2 antibody
    • Secreted protein G 26 antibody
    • Secreted protein G26 antibody
    • SIS gamma antibody
    • SIS-gamma antibody
    • Small inducible cytokine A4 (homologous to mouse Mip 1b) antibody
    • Small inducible cytokine A4 antibody
    • small inducible cytokine A4-like antibody
    • Small-inducible cytokine A4 antibody
    • T cell activation protein 2 antibody
    • T-cell activation protein 2 antibody
    see all

Images

  • All lanes : Anti-Macrophage Inflammatory Protein 1 beta antibody (ab25129) at 1/2000 dilution

    Lane 1 : lysate
    Lane 2 : supernatant


    Predicted band size : 10 kDa
    ab25129 staining by Western Blot in RAW264.7 cells treated with LPS for 15 hours.
  • ICC/IF image of ab25129 stained Raw264.7 cells. The cells were 100% Methanol fixed (5 min) and then incubated in 1%BSA / 10% normal Goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab25129, 5µg/ml) overnight at +4°C. The secondary antibody (green) was ab96899, DyLight® 488 Goat anti-Rabbit IgG (H+L) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

References

This product has been referenced in:
  • Tomas-Sanchez C  et al. Prophylactic Chronic Zinc Administration Increases Neuroinflammation in a Hypoxia-Ischemia Model. J Immunol Res 2016:4039837 (2016). ELISA ; Rat . Read more (PubMed: 27635404) »
  • Leng Y  et al. Effects of acute intra-abdominal hypertension on multiple intestinal barrier functions in rats. Sci Rep 6:22814 (2016). Read more (PubMed: 26980423) »

See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab25129.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up