Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Sequence
      MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIV

Specifications

Our Abpromise guarantee covers the use of ab113702 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Constituent: 100% dH2O

General Info

  • Alternative names
    • AA545192
    • Basic leucine zipper transcription factor MafG
    • C630022N07Rik
    • hMAF
    • MAFG
    • MAFG v maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian)
    • MAFG_HUMAN
    • MGC13090
    • MGC20149
    • RP23 84C12.9
    • Transcription factor MafG
    • V maf musculoaponeurotic fibrosarcoma oncogene homolog G
    • V-maf musculoaponeurotic fibrosarcoma oncogene homolog G
    see all
  • Function
    Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they seem to serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins and recruiting them to specific DNA-binding sites. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NF-E2 transcription factor. Transcription factor, component of erythroid-specific transcription factor NF-E2. Activates globin gene expression when associated with NF-E2. May be involved in signal transduction of extracellular H(+).
  • Tissue specificity
    Highly expressed in skeletal muscle. Also expressed in heart and brain.
  • Sequence similarities
    Belongs to the bZIP family. Maf subfamily.
    Contains 1 bZIP domain.
  • Post-translational
    modifications
    Acetylated in erythroid cells by CREB-binding protein (CBP). Acetylation augments the DNA-binding activity of NFE2, but has no effect on binding NFE2.
    Sumoylation at Lys-14 is required for active transcriptional repression.
  • Cellular localization
    Nucleus.
  • Information by UniProt

References

ab113702 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113702.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up