Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Sequence
      MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIV

Specifications

Our Abpromise guarantee covers the use of ab113702 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Constituent: 100% dH2O

General Info

  • Alternative names
    • AA545192
    • Basic leucine zipper transcription factor MafG
    • C630022N07Rik
    • hMAF
    • MAFG
    • MAFG v maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian)
    • MAFG_HUMAN
    • MGC13090
    • MGC20149
    • RP23 84C12.9
    • Transcription factor MafG
    • V maf musculoaponeurotic fibrosarcoma oncogene homolog G
    • V-maf musculoaponeurotic fibrosarcoma oncogene homolog G
    see all
  • Function
    Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they seem to serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins and recruiting them to specific DNA-binding sites. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NF-E2 transcription factor. Transcription factor, component of erythroid-specific transcription factor NF-E2. Activates globin gene expression when associated with NF-E2. May be involved in signal transduction of extracellular H(+).
  • Tissue specificity
    Highly expressed in skeletal muscle. Also expressed in heart and brain.
  • Sequence similarities
    Belongs to the bZIP family. Maf subfamily.
    Contains 1 bZIP domain.
  • Post-translational
    modifications
    Acetylated in erythroid cells by CREB-binding protein (CBP). Acetylation augments the DNA-binding activity of NFE2, but has no effect on binding NFE2.
    Sumoylation at Lys-14 is required for active transcriptional repression.
  • Cellular localization
    Nucleus.
  • Information by UniProt

References for MAFG peptide (ab113702)

ab113702 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113702.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up