Anti-MAGEB5 antibody - N-terminal (ab185316)

Overview

  • Product name
    Anti-MAGEB5 antibody - N-terminal
  • Description
    Rabbit Polyclonal to MAGEB5 - N-terminal
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MAGEB5 aa 8-53 (N terminal).
    Sequence:

    NAGSDERANSRDEEYPCSSEVSPSTESSCSNFINIKVGLLEQFLLY


    Database link: Q9BZ81

  • Positive control
    • Human testis tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab185316 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance
    The function of this protein remains unknown.
  • Database links
  • Alternative names
    • Cancer/testis antigen 3.3 antibody
    • Cancer/testis antigen family 3, member 3 antibody
    • CT3.3 antibody
    • MAGE family testis and tumor-specific protein antibody
    • MAGE-B5 antibody
    • MAGE-B5 antigen antibody
    • Melanoma antigen family B, 5 antibody
    • Melanoma-associated antigen B5 antibody
    see all

Images

  • Immunohistochemical analysis of Paraffin-embedded Human testis tissue labeling MAGEB5 with ab185316 at 1/200 dilution.

References

ab185316 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185316.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up