Anti-MAGEF1 antibody - N-terminal (ab187990)

Overview

  • Product name
    Anti-MAGEF1 antibody - N-terminal
    See all MAGEF1 primary antibodies
  • Description
    Rabbit polyclonal to MAGEF1 - N-terminal
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MAGEF1 aa 1-59 (N terminal).
    Sequence:

    MLQTPESRGLPVPQAEGEKDGGHDGETRAPTASQERPKEELGAGREEGAA EPALTRKGA


    Database link: Q9HAY2

  • Positive control
    • Human lymph node tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab187990 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded Human lymph node tissue labeling MAGEF1 with ab187990 at 1/20 dilution.

References

ab187990 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187990.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up