Overview

  • Product name
    Anti-Major Basic Protein antibody
  • Description
    Rabbit polyclonal to Major Basic Protein
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Major Basic Protein aa 17-222.
    Sequence:

    LHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSED ASKKDGAVES ISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCR RCYRGNLVSI HNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWA AHQPWSRGGH CVALCTRGGHWRRAHCLRRLPFICSY


    Database link: P13727

  • Positive control
    • BT474, MCF7, HL-60, Mouse kidney, Mouse heart and Mouse spleen extracts.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab187523 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 25 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function
    Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA.
  • Tissue specificity
    High levels of the proform in placenta and pregnancy serum; in placenta, localized to X cells of septa and anchoring villi. Lower levels in a variety of other tissues including kidney, myometrium, endometrium, ovaries, breast, prostate, bone marrow and colon.
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Developmental stage
    Levels of the proform increase in serum and placenta during pregnancy.
  • Post-translational
    modifications
    Nitrated.
  • Cellular localization
    Cytoplasmic vesicle > secretory vesicle. The proform is secreted. The mature protein is found in the matrix of the eosinophil's large specific granule and Secreted. The proform is secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • BMPG antibody
    • Bone marrow proteoglycan antibody
    • EMBP antibody
    • Eosinophil granule major basic protein antibody
    • Eosinophil major basic protein antibody
    • MBP antibody
    • MBP1 antibody
    • MGC14537 antibody
    • Natural killer cell activator antibody
    • Pregnancy associated major basic protein antibody
    • Pregnancy-associated major basic protein antibody
    • PRG 2 antibody
    • PRG2 antibody
    • PRG2_HUMAN antibody
    • Proteoglycan 2 antibody
    • Proteoglycan 2 bone marrow antibody
    • Proteoglycan 2 preproprotein antibody
    • Proteoglycan2 antibody
    see all

Images

  • All lanes : Anti-Major Basic Protein antibody (ab187523) at 1/500 dilution

    Lane 1 : BT474 cell extract
    Lane 2 : MCF7 cell extract
    Lane 3 : HL-60 cell extract
    Lane 4 : Mouse kidney extract
    Lane 5 : Mouse heart extract
    Lane 6 : Mouse spleen extract


    Predicted band size : 25 kDa

References

This product has been referenced in:
  • Tamarozzi F  et al. Wolbachia endosymbionts induce neutrophil extracellular trap formation in human onchocerciasis. Sci Rep 6:35559 (2016). IHC-P ; Human . Read more (PubMed: 27752109) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187523.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up