• Product nameAnti-MAK antibody
    See all MAK primary antibodies
  • Description
    Rabbit polyclonal to MAK
  • Tested applicationsSuitable for: WB, ELISA, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region between C terminal residues 575 and 624 (WNTKTGRGQFSGRTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR) of Human MAK (NP_005897).

  • Positive control
    • Hela cell lysate.


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas


Our Abpromise guarantee covers the use of ab80536 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 71 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/312500.

ICC/IF 1/100.


  • FunctionEssential for the regulation of ciliary length and required for the long-term survival of photoreceptors (By similarity). Phosphorylates FZR1 in a cell cycle-dependent manner. Plays a role in the transcriptional coactivation of AR. Could play an important function in spermatogenesis. May play a role in chromosomal stability in prostate cancer cells.
  • Tissue specificityExpressed in prostate cancer cell lines at generally higher levels than in normal prostate epithelial cell lines. Isoform 1 is expressed in kidney, testis, lung, trachea, and retina. Isoform 2 is retina-specific where it is expressed in rod and cone photoreceptors.
  • Involvement in diseaseDefects in MAK are the cause of retinitis pigmentosa type 62 (RP62) [MIM:614181]. RP62 is a retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well.
  • Sequence similaritiesBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    Autophosphorylated. Phosphorylated on serine and threonine residues.
  • Cellular localizationNucleus. Cytoplasm > cytoskeleton > centrosome. Cytoplasm > cytoskeleton > spindle. Midbody. Cell projection > cilium > photoreceptor outer segment. Photoreceptor inner segment. Localized in both the connecting cilia and the outer segment axonemes (By similarity). Localized uniformly in nuclei during interphase, to the mitotic spindle and centrosomes during metaphase and anaphase, and also to midbody at anaphase until telophase.
  • Information by UniProt
  • Database links
  • Alternative names
    • intestinal cell kinase antibody
    • dJ417M14.2 antibody
    • fj04c02 antibody
    • Ick antibody
    • Mak antibody
    • MAK_HUMAN antibody
    • Male germ cell associated kinase antibody
    • Male germ cell-associated kinase antibody
    • male germ cell-associated kinase retinal-enriched isoform antibody
    • OTTHUMP00000016025 antibody
    • Rck antibody
    • RP62 antibody
    • Serine/threonine protein kinase MAK antibody
    • Serine/threonine-protein kinase MAK antibody
    • testicular secretory protein Li 28 antibody
    • wu:fj04c02 antibody
    • zgc:56603 antibody
    see all

Anti-MAK antibody images

  • Anti-MAK antibody (ab80536) at 1 µg/ml (in 5% skim milk / PBS buffer) + Hela cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 71 kDa
    Observed band size : 71 kDa
    Gel concentration: 12%
  • All lanes : Anti-MAK antibody (ab80536) at 1 µg/ml

    Lane 1 : Human pancreatic cancer cell line MiaPaca-2
    Lane 2 : Human pancreatic cancer cell line Panc-1

    Predicted band size : 71 kDa
    WB Suggested Anti-CDC45L Antibody (ab82805) Titration: 0.5 µg/ml Positive Control: mouse stem cells

  • Immunofluorescence analysis of Human lung adenocarcinoma cell line A549 staining MAK with ab80536 at 2.5 µg/ml.

References for Anti-MAK antibody (ab80536)

ab80536 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab80536.
Please use the links above to contact us or submit feedback about this product.