Overview

  • Product name
  • Description
    Rabbit polyclonal to MAK16
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Xenopus laevis, Zebrafish, Xenopus tropicalis
  • Immunogen

    Recombinant fragment corresponding to Human MAK16 aa 104-193 (internal sequence).
    Sequence:

    FIRHKCKQRFTKITQYLIRIRKLTLKRQRKLVPLSKKVERREKRREEKAL IAAQLDNAIEKELLERLKQDTYGDIYNFPIHAFDKALEQQ


    Database link: Q9BXY0

  • Positive control
    • Human cerebellum tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab185101 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded Human cerebellum tissue, labeling MAK16 using ab185101 at a 1/2500 dilution.

References

ab185101 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185101.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up