Overview

  • Product name
  • Description
    Rabbit polyclonal to MANBA
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MANBA aa 782-874.
    Sequence:

    LSPTNYHFLSSPKEAVGLCKAQITAIISQQGDIFVFDLETSAVAPFVWLD VGSIPGRFSDNGFLMTEKTRTILFYPWEPTSKNELEQSFHVTS


    Database link: O00462

  • Positive control
    • Human prostate tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab185288 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Exoglycosidase that cleaves the single beta-linked mannose residue from the non-reducing end of all N-linked glycoprotein oligosaccharides.
  • Pathway
    Glycan metabolism; N-glycan degradation.
  • Involvement in disease
    Defects in MANBA are the cause of a mild disorder that affects peripheral and central nervous system myelin.
    Mannosidosis, beta A, lysosomal
  • Sequence similarities
    Belongs to the glycosyl hydrolase 2 family.
  • Cellular localization
    Lysosome.
  • Information by UniProt
  • Database links
  • Alternative names
    • Beta-mannosidase antibody
    • GC04M103771 antibody
    • Lysosomal beta A mannosidase antibody
    • Manba antibody
    • MANBA_HUMAN antibody
    • Mannanase antibody
    • Mannase antibody
    see all

Images

  • Immunohistochemical analysis of human prostate labeling MANBA with ab185288 at 1/50 dilution

References

ab185288 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185288.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up