Overview

  • Product nameAnti-MAP3K8 antibody
    See all MAP3K8 primary antibodies
  • Description
    Rabbit polyclonal to MAP3K8
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Horse
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 36-85 (

    SEEPAVYEPSLMTMCQDSNQNDERSKSLLLSGQEVPWLSSVRYGTVEDLL

    ) of Human MAP3K8 (NP_005195)

  • Positive control
    • THP-1 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab94899 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 53 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionRequired for TLR4 activation of the MEK/ERK pathway. Able to activate NF-kappa-B 1 by stimulating proteasome-mediated proteolysis of NF-kappa-B 1/p105. Plays a role in the cell cycle. The longer form has some transforming activity, although it is much weaker than the activated cot oncoprotein.
  • Tissue specificityExpressed in several normal tissues and human tumor-derived cell lines.
  • Sequence similaritiesBelongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
    Contains 1 protein kinase domain.
  • Developmental stageIsoform 1 is activated specifically during the S and G2/M phases of the cell cycle.
  • Post-translational
    modifications
    Autophosphorylated. Isoform 1 undergoes phosphorylation mainly on Ser residues, and isoform 2 on both Ser and Thr residues.
  • Cellular localizationCytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • c COT antibody
    • Cancer Osaka thyroid oncogene antibody
    • CCOT antibody
    • COT antibody
    • COT proto oncogene serine/threonine protein kinase antibody
    • EST antibody
    • ESTF antibody
    • Ewing sarcoma transformant antibody
    • FLJ10486 antibody
    • M3K8_HUMAN antibody
    • MAP3K 8 antibody
    • MAP3K8 antibody
    • MEKK8 antibody
    • Mitogen activated protein kinase kinase kinase 8 antibody
    • Mitogen-activated protein kinase kinase kinase 8 antibody
    • Proto oncogene cCot antibody
    • Proto-oncogene c-Cot antibody
    • Serine/threonine protein kinase cot antibody
    • Serine/threonine-protein kinase cot antibody
    • TPL 2 antibody
    • TPL-2 antibody
    • TPL2 antibody
    • Tumor progression locus 2 antibody
    see all

Anti-MAP3K8 antibody images

  • Anti-MAP3K8 antibody (ab94899) at 1 µg/ml + THP-1 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 53 kDa

References for Anti-MAP3K8 antibody (ab94899)

ab94899 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab94899.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"